KEGG   Thiobacillus denitrificans: Tbd_0096Help
Entry
Tbd_0096          CDS       T00275                                 

Definition
phospholipase (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tbd_0096
   00565 Ether lipid metabolism
    Tbd_0096
   00590 Arachidonic acid metabolism
    Tbd_0096
   00591 Linoleic acid metabolism
    Tbd_0096
   00592 alpha-Linolenic acid metabolism
    Tbd_0096
Enzymes [BR:tbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Tbd_0096
    3.1.1.32  phospholipase A1
     Tbd_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
102280..103338
Genome map
AA seq 352 aa AA seqDB search
MKMKPPALSLAVLPLALALAGPAFAASVADWEGCSAIPADVDRLACYDRVSGRVPEAEAA
ATPAADGIAMEPAPVAEAQPADAPSLLSALSRHWELDDEAKQGAFLFRPHRPNYFLPLKY
STRPNDTPFRDTFSHSDLGLDSIETEVQLSFKIKGMEGVFGYDNVDLWFGYTASSFWQAY
NGTISSPFRETNYEPEAMLVFRTDYDIAGFRGRFINLGLSHQSNGRGEDLSRSWNRVYAQ
FGFERDNLALLIRPWYRLPEHDEDDNPNIEDYMGHGDLLAVYRKGRNAYSLLLRNNFKRS
DNRGAFELSWSFPLHGRLKGYVQYFNGYGESLIDYNHRQQSLGFGFSLAEGM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaacctcccgcactttccctggcagtcctcccgctcgcgcttgcgctcgcg
ggtcccgctttcgccgcctcggtcgccgactgggagggctgcagcgcgatccctgccgac
gtcgaccgccttgcctgttacgaccgcgtgtcggggcgcgtgcccgaggcagaggccgcg
gcgacgcccgccgcggacggaatcgcgatggaaccggcgccggtcgccgaggcccagccc
gcggatgcgccgagcctgctctcggcgctctcgcgtcactgggaactcgacgacgaggcc
aagcagggcgccttcctattccgcccgcatcgccccaactatttcctgccgctcaagtac
agcacgcggcccaacgacacgcctttccgcgacaccttttcgcattccgacctcggcctt
gattcaatcgagaccgaagtgcagctcagcttcaagatcaaggggatggaaggcgtcttc
ggctacgacaatgtcgacctctggttcggctataccgcgagctcgttctggcaggcctac
aacggcacgatctcatcgccgttcagggagaccaactacgagcccgaggcgatgctggtg
tttcgaaccgactacgacatcgccgggtttcgcgggcgtttcatcaacctcggcctgtcg
caccagtcgaacggccgtggcgaggacctgtcgcgcagctggaatcgggtctacgcgcaa
ttcggtttcgagcgcgacaacctcgcgctgctgatccggccctggtatcggctgcccgaa
catgacgaagacgacaacccgaacatcgaggactacatgggccacggcgacctgctcgcg
gtctaccgcaagggccgcaacgcctattcgctcctgctgcgtaacaatttcaagcgctcc
gacaatcgcggcgcgttcgaactcagctggagctttccgctgcacggccggctgaaaggc
tacgtgcagtatttcaacggctacggcgagtcgctgatcgactacaaccaccgccaacag
tcgctcggtttcggcttcagcctggccgagggcatgtag

DBGET integrated database retrieval system