KEGG   Thiobacillus denitrificans: Tbd_0383Help
Entry
Tbd_0383          CDS       T00275                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tbd  Thiobacillus denitrificans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tbd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(411196..412008)
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRAGLSPRLQGRVLTRVIVREPRLRWPIPPDLDTQLRGLTLHGLARRGKYL
LFDFGAVTQLVHLGMSGSLRLTEPAEPAARHDHVDWRFDDGTILRLRDPRRFGAVLLTEN
APGHPLLAGLGPEPLSTAFDAAYLHTQCQRRKTAIKPLIMDAHVVVGVGNIYASESLFHA
GIRPGVAAHRLSRAACARLADAIKQVLTAAIAAGGSSLRDYVQSSGELGYFQLQTRVYDR
EDAPCRRCATPIRRIVQAQRASFYCPTCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactacccgaagtcgagaccacccgcgccggcctgtcgccccgtttgcagggt
cgcgtgctgacccgcgtcatcgttcgcgagccgcgtctgcgctggccgatcccgcccgac
ctcgacacgcaattgcggggcctcacgctccacggcctcgcccggcgcggcaaatacctg
ctgttcgacttcggcgctgtcacccagctcgtccatctcggcatgtcggggagcctgcgc
ctcaccgagcccgcggagcccgctgcgcgccacgaccacgtcgactggcgcttcgacgac
ggaacgatcctgcgcctgcgcgacccgcgccgcttcggcgcggtgctgctgaccgagaac
gcgcccggacatccgctcctcgccggcctcggtccggaacccctgagcacggcgttcgac
gcggcctatctgcacacgcagtgccagcgtcgcaagaccgcgatcaagccgctcatcatg
gatgcccatgtcgtcgtcggcgtcggtaacatctacgcttcggaatccttgttccacgcc
ggaatccgcccgggcgtcgccgcccaccgcctaagccgggcggcgtgcgcgcggctggcc
gacgcgatcaaacaggtgttgactgcggccatcgcagcaggcggcagttcgctgcgggac
tacgtccaaagcagcggcgaactggggtatttccagttgcagacgcgggtctacgaccgc
gaagacgcgccgtgcaggcggtgcgcaacgccgatccgccgcatcgtccaggcgcagcgt
gcgagcttctactgcccgacgtgccagcgctga

DBGET integrated database retrieval system