KEGG   Thiobacillus denitrificans: Tbd_0386Help
Entry
Tbd_0386          CDS       T00275                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tbd  Thiobacillus denitrificans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tbd_0386
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tbd_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
414539..415375
Genome map
AA seq 278 aa AA seqDB search
MSQAFPAPAKLNLFLHVVGRRDDGYHLLQSVFRLIDRADTVHLELRDDGRIVREGALPGV
SEDQDLTVRAARLLQPYARPGAGVGIRLDKRLPMGGGLGGGSSDAATVLLALNRLWEVDL
PRQRLQALALRLGADVPVFVFGQTAFAEGVGELLQPIGAPVAWYVVLTPPVHVPTAAIFA
APELTRNTPALKIAPFSAGMGHNDLEPVVVGRYPEVGRHLQWLGQFGEARMTGSGACVFA
SFATEDAARSVLQALPDTMQGFVARGLDKHPLYDFVPE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggcgtttcccgcgccggcgaagctcaatcttttcctccacgtcgtcggtcgc
cgcgacgacggataccatctgctgcagagcgtgtttcgtctgatcgaccgcgccgacacc
gtgcacctggaattgcgcgatgacggccgaatcgtgcgcgaaggcgctttgccgggcgtg
agcgaagatcaggatctgaccgtccgcgcggcccgactcctgcagccctacgcgcgcccg
ggcgccggggtcggcatccgtctcgacaagcggctgccgatgggcgggggcctcggcggc
ggcagttccgatgcggcgaccgtgctgctcgcgctcaaccgcctgtgggaggtcgatctg
ccgcgccagcgcttgcaggcgctcgccctgcgactcggcgccgacgtgccggtcttcgtt
ttcggtcagacggcgttcgcggagggggtcggcgaactgttgcagccgatcggcgcgccg
gtcgcgtggtacgtcgtgctgacgccgccggtgcacgtgccgaccgcggcaatttttgcc
gcgccggaattgacacgcaacacgcctgccctcaaaatagcgcccttttccgcgggcatg
ggtcataacgacctcgagcccgtggtcgtcggccggtacccggaagtcggtcgccacctg
cagtggctcggtcagttcggggaggcgcggatgaccggttcgggcgcctgcgttttcgca
tcgttcgcaaccgaggatgccgcgcgcagcgtgctgcaggcgctgcccgatacgatgcag
ggttttgtggcgcgaggtctggacaagcaccccttgtacgactttgtgcctgagtag

DBGET integrated database retrieval system