KEGG   Thiobacillus denitrificans: Tbd_0579Help
Entry
Tbd_0579          CDS       T00275                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tbd  Thiobacillus denitrificans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tbd_0579
   00240 Pyrimidine metabolism
    Tbd_0579
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tbd_0579
   03430 Mismatch repair
    Tbd_0579
   03440 Homologous recombination
    Tbd_0579
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Tbd_0579
DNA replication proteins [BR:tbd03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Tbd_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(609106..609537)
Genome map
AA seq 143 aa AA seqDB search
MTEIIFYTFAEDRLDVARRVAAKAYGQGKQVMIYAPDAAVAGAVDRMLWTTPALGFVPHA
RDSDALAAETPVLIGADAGALRHADVMINLDSAQPPAFGRFERLVEIVGTDDAEREQGRA
RYRFYQSRGYALKTHDLRQQSEG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagatcatcttctatacctttgccgaagaccgcctcgacgtcgcgcgccgcgtg
gcggccaaggcctacggtcaaggcaagcaggtgatgatctatgcgcccgatgcggccgtc
gcaggcgcggtggatcgcatgctgtggacgacaccggcgctcggtttcgtgccgcatgcc
cgcgacagcgacgcactcgcggcggaaacgccggtgctgatcggcgccgacgccggcgca
ctccgccacgccgacgtgatgatcaatctcgattccgcgcaaccgccggccttcggccgc
ttcgagcggctcgtcgaaatcgtcggcacggacgacgcggagcgcgaacagggccgcgcg
cgctatcgcttctatcagtcgcgcggctacgcgctgaagacgcacgatctgcgccagcag
agcgagggatga

DBGET integrated database retrieval system