KEGG   Thiobacillus denitrificans: Tbd_0625Help
Entry
Tbd_0625          CDS       T00275                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbd  Thiobacillus denitrificans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tbd_0625
   00052 Galactose metabolism
    Tbd_0625
   00500 Starch and sucrose metabolism
    Tbd_0625
   00520 Amino sugar and nucleotide sugar metabolism
    Tbd_0625
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tbd_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
658040..658909
Genome map
AA seq 289 aa AA seqDB search
MQQVRKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMDAGITDIIFVSSRT
KRTVEDHFDKAYELETELAARGKNRDLELVQSIRPAGVNFIYIRQAEALGLGHAVLCARP
VVGEEPFAVILADDLLDGATSVMKQMVDQYSYYQCSVLGVQQVAPEDTASYGIVDATPLA
DRVSRVNAIVEKPKPEEAPSTLGVVGRYILTPRIFDHIQQITPGAGGELQLTDAIAGLLK
EQQVLAYAYDGVRYDCGSKLGYLQATVEYALKHKEVAADFEAYLKTRMC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagtcagaaaagcagtatttccggttgccggcctcggcacccgttttttgccg
gcgaccaaggccagccccaaggagatgctcccgatcgtcgacaagccgctgatccagtac
gcagtcgaggaggcgatggacgcgggtatcaccgacatcatcttcgtcagcagccgcacc
aagcgcacggtcgaggaccatttcgacaaggcctacgaactcgaaaccgaactcgctgcg
cgcggcaagaaccgtgatctcgaactcgtgcagtcgatccgcccggccggggtcaatttc
atctacatccgccaggccgaggcgctcgggctcggccatgccgtgctctgcgcgcgcccc
gtcgtcggcgaggaacccttcgcggtgatcctggccgacgacctgctcgacggcgcgacg
tcggtcatgaagcagatggtcgaccagtacagctattaccagtgctcggtcctcggcgta
cagcaggtcgcgccggaagacacggcatcctacggcatcgtcgacgcgactccgctcgcc
gatcgggtgtcgcgcgtcaacgcgatcgtcgaaaaacccaagcccgaagaagcgccgtcg
accctcggcgtcgtgggtcgctacatcctgacgccgcgcatcttcgaccacatccagcag
atcacgccgggcgcgggcggcgaactgcagctgaccgacgcgatcgccgggctgctgaag
gagcagcaggttctcgcttacgcctacgacggcgtgcgctacgactgcggaagcaagctc
ggctacctgcaggcgaccgtcgaatacgccctgaagcacaaggaagtcgcagccgacttc
gaggcctacctcaagacgcggatgtgctga

DBGET integrated database retrieval system