KEGG   Thiobacillus denitrificans: Tbd_0686Help
Entry
Tbd_0686          CDS       T00275                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tbd  Thiobacillus denitrificans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tbd_0686
Enzymes [BR:tbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Tbd_0686
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Tbd_0686
Lipid biosynthesis proteins [BR:tbd01004]
 Fatty acid synthase
  Component type
   Tbd_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
727386..728006
Genome map
AA seq 206 aa AA seqDB search
MDYRVWSLLLLLLPGSAAAASCSLLILGDSLSSGYGLAAGQGWVDRLRARMRDAAPDWRV
VNASVSGDTTQNGLQRLEPTLQRQRPQGVVIELGGNDALRGTPPAQIRRNLVTLVRQAKA
SGAWVLLLEPPVLPNYGRAYADAVARLAAEVARSEKVTHVPCFVCEVGVKPGMMQPDGIH
PNEKGQSGMLEAVWPYLRPKLECPGK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggattatcgcgtgtggagcttgttgttgctgttgttgcccggttcggcggcggccgcc
tcgtgctcgctgttgatcctcggcgacagcttgagttccggctacgggctcgccgcgggg
cagggctgggtcgaccggctgcgggcccgcatgcgcgacgcggcgcccgactggcgcgtc
gtcaacgcgagcgtgagcggcgacacgacgcagaacgggttgcagcggctcgaaccgacg
ctgcagcggcagcgtccccaaggggtcgtgatcgagctcggcggcaacgacgccttgcgc
ggcacgccccccgcgcagatccgtcgcaatctcgtcacgctggtgcggcaggcgaaggcg
agcggcgcctgggtgttgctgctcgagccgccggtgttgccgaattacggccgcgcctac
gccgatgcggtcgccagactcgcggccgaggttgcgcgcagtgaaaaggtcacccacgtg
ccgtgcttcgtctgcgaggtcggcgtgaagccggggatgatgcagcccgacggcatccat
ccgaacgaaaaagggcagtccggcatgctcgaggccgtctggccctacctccgtcccaag
ctggagtgccccggcaaatga

DBGET integrated database retrieval system