KEGG   Thiobacillus denitrificans: Tbd_0791Help
Entry
Tbd_0791          CDS       T00275                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00900  Terpenoid backbone biosynthesis
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tbd_0791
Enzymes [BR:tbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tbd_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AAZ96744
JGI: Tbd0791
UniProt: Q3SKN3
Position
833188..834372
Genome map
AA seq 394 aa AA seqDB search
MRRRVLTVLGATGTIGVNTLDVVSRHPERFEIFALTGATQVERMFEQCRAHRPRFAVMSE
PAAAAALRARLAADGLAVEVLEGAAALTEVAIAAEVDTVMAAIVGAAGLPATLAAARAGK
RILLANKETLVVSGQLFMDAVAASGAELLPIDSEHNAIFQALPRGFDGDFQRAGVNTLWL
TASGGPFRTLSAEAIAAATPEQAVAHPNWVMGRKISVDSASLMNKGLEVIEARWLFNARP
EQIKVLVHPQSIVHSMVEYVDGSVVAQMGTPDMRTPIAYALGFPERIAAGVPMLELMGRQ
LTFEAPDTVRFPCLQLAFDALAAGGNAAAVLNAANEVAVARFLEGAISFGGIAASIAHAL
DAVAGGRADTLDELLDADHRARRVADDYLRCSYA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgccgcgttctcaccgtccttggcgcgaccgggacgataggcgtcaatacgctc
gacgtcgtttcacgccaccccgaacgcttcgagatcttcgcgctcacgggcgcgacccag
gtcgaacgcatgtttgagcagtgccgcgcgcaccggccgcgcttcgccgtcatgagcgag
ccggccgcggcggcggcgttgcgcgcgcgacttgcggccgacggccttgcggtcgaggtg
ctcgaaggcgcggccgcgctgacagaggtcgcgatcgcggccgaagtcgataccgtcatg
gcggcgatcgtcggcgccgccggtctgccggcgacgctcgcggcggcgcgcgcgggcaag
cgcatcctgctcgccaacaaggaaaccctcgtcgtctcgggccagcttttcatggacgcg
gtcgccgccagcggcgccgaactcctgccgatcgattcggaacacaacgcgatcttccag
gccttgccgcgcggattcgacggtgatttccagcgcgccggcgtcaatacgctgtggctc
accgcctccggcggccccttccgcacgctgtcggccgaggccatcgcggcggcgacaccc
gagcaggcagtggcgcatccgaactgggtcatgggcagaaagatctcggtcgattcggcg
agcctcatgaacaaggggctcgaagtgatcgaggcgcgctggctgttcaacgcgcgtccc
gagcagatcaaggtactcgtgcacccgcagagcatcgtgcattcgatggtcgaatacgtc
gacggctcggtggtcgcgcaaatgggcacgcccgacatgcgcacgccgatcgcgtacgca
ctcggctttcccgaacggatcgccgccggcgtgccgatgctcgaactcatgggcaggcag
ctcacgttcgaagcgcccgacacggtgcgctttccctgtctgcagctcgccttcgacgcg
ctcgcggccggcggcaacgccgctgccgtgctgaacgcggccaacgaggtcgcggtcgca
cggtttctcgaaggcgcgatctcgtttggcggcatcgccgcgagcatcgcccacgccctc
gatgcggtggccggggggcgcgccgacacgctcgacgagctgctcgacgccgaccaccgg
gcgcgtcgcgtcgccgacgactatctcaggtgcagctacgcatga

DBGET integrated database retrieval system