KEGG   Thiobacillus denitrificans: Tbd_0844Help
Entry
Tbd_0844          CDS       T00275                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbd_0844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbd_0844
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tbd_0844
Enzymes [BR:tbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tbd_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
893626..895068
Genome map
AA seq 480 aa AA seqDB search
MNYLSTRGLAPQLRFSDILLGGLADDGGLYVPEAYPRFTAAELEAMRAMNYRELAFAVLS
RLVDDIPADDLRALIDKTYTADVYRYVGRGENAADITPLKTLEPGLHVLALSNGPTLAFK
DMAMQLLGNLFEYVLGKTGGELNIVGATSGDTGSAAEYAMRGKKGVRVFMLSPEHGMTRF
QQAQMYALRDDNIHNLVIRGVFDQCQDMVKAVANDLPFKAKYHIGAVNSINWARVAAQSV
YYFKAYFAATHSNTQSVSFSVPSGNFGNVYAGHVARQMGLPINKLIVATNENDVLDEFFK
TGVYRPRPETKHTSSPSMDISKASNFERFVFDLSGRDVAKVRDLWRAVESGGSFDLKTHA
APGGGSLFERIADFGMVSGSSNHANRIDTIRTVYEVYGTMIDPHTADGLKVGLEHREPGV
PLVCMETAQPAKFEDAIREALGIDPVRPAELADLETQPQKKHVMDADVDAVKRFLVEHAG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctcagcacgcggggcctcgcgccgcaactccgcttttccgacatcctgctc
ggcgggctggccgacgacggcggcctctacgtgcccgaggcgtacccgcgtttcacggcg
gccgagctcgaggcgatgcgggcgatgaactaccgcgaactcgcgttcgcggtgctgtcg
cgactcgtcgacgacattccggcggacgacctgcgcgcgctgatcgacaagacctatacc
gccgacgtctaccgctatgtcggccgcggcgagaatgctgccgacatcacgccgctcaag
acgctggagcccggtctgcacgtgctcgcgctgtcgaacggcccgacgctcgcgttcaag
gacatggcgatgcagctcctcggcaacctgttcgagtacgtgctcggcaagaccgggggc
gaactcaacatcgtcggcgcgacctcgggcgacacgggttcggcggccgaatacgccatg
cgcggcaagaagggcgtgcgcgtcttcatgctgtcgccggagcatggcatgacgcgcttc
cagcaggcgcagatgtacgcgctgcgcgacgacaacatccacaacctcgtgattcgcggc
gtcttcgaccaatgccaggacatggtcaaggccgtggcgaacgacctgccgttcaaggcg
aaataccatatcggcgcggtcaactcgatcaactgggcgcgcgtcgcggcgcagagcgtc
tactacttcaaggcgtatttcgcggcgacccacagcaacacgcaaagcgtttcgttctcg
gtgccgtcgggcaatttcggcaacgtctatgccgggcacgtcgcgcgccagatgggcctg
ccgatcaacaagctgatcgtcgcgaccaacgagaacgacgtgctcgacgaattcttcaag
accggcgtctaccgtccgcgcccggagacaaaacacacgtcgagcccctcgatggatatt
tccaaggcatcgaatttcgaacgcttcgtcttcgacctgagcggccgcgacgtcgcgaag
gtgcgcgacctctggcgcgcggtcgagtcgggcggcagcttcgatctcaagacccacgcc
gcgccgggcggcggcagcttgttcgagcgcatcgccgatttcggcatggtctcgggttcg
agcaaccatgccaaccgcatcgacacgatccgtacggtctacgaggtctacggcacgatg
atcgatccacacacggccgacggcctcaaggtcgggctcgagcaccgcgagccgggcgtg
ccgctcgtgtgcatggaaacggcgcagcccgccaagttcgaggacgcgattcgcgaagcg
ctcggcatcgacccggtccgtccggccgagctcgccgacctcgaaacccagccgcagaag
aagcacgtcatggacgccgacgtcgatgcggtcaagcgcttcctcgtcgaacacgccggc
tga

DBGET integrated database retrieval system