KEGG   Thiobacillus denitrificans: Tbd_0948Help
Entry
Tbd_0948          CDS       T00275                                 

Definition
DNA gyrase subunit A (EC:5.99.1.3)
Orthology
K02469  
DNA gyrase subunit A [EC:5.99.1.3]
Organism
tbd  Thiobacillus denitrificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1008562..1011111
Genome map
AA seq 849 aa AA seqDB search
MEQFAKETLPVSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNELGNDWN
KAYKKSARVVGDVIGKYHPHGDTAVYDTMVRMAQDFSLRYPLIDGQGNFGSVDGDNAAAM
RYTEVRMARIAHELLADLDKETVDFGPNYDGSEQEPLVLPTKIPNLLINGSSGIAVGMAT
NIPPHNLTDICNALFALLDAPATDIESLISIVQAPDFPTAGIIYGLSGVRDGYRTGRGRV
VMRATCHVEDLDKSGGKQAIIIDELPYQVNKANLLIRIGELVRDKQIDGIADLRDESDKS
GMRVYIELKRGENADVVLNNLYKQTQMQDTFGMNMVALIDGQPRLLNLKEMLDAFLRHRR
EVVTRRTVFDLRKARERGHILEGLAVALANVDEIVELIKSSETPAIAKERLLGRAWKSAM
VEEMLARIDPEYSRPVNMGPEFGLHADGYHLSEIQAQRILEMQLQRLTNLESDKILAEYK
EIMAKIADLLDILANPARITQIIREELTQVRDQFGDGRRSTIVENAQDMSMEDLIKPEEM
VVTLSHGGYMKSQPLDDYRAQKRGGRGKQAAGTKDEDFIEKMFVANTHDYILCFSNRGRL
YWLKVYNVPQGGRAARGKPIVNLLPLEDGEKISALLPVKTFDDEHYVFMATANGIVKKTP
LSEFSRPRTAGIIAVGLDDGDVLCGASITDGRHDVMLFSDSGKAVRFDENDVRPMGRAAR
GVIGMKLAKGAKLISLLVAEDENDFVLTATENGYGKRTPIAEYTRHARATQGMIAIQTSE
RNGKVVAANLVKADDEIMLITTGGVLIRTRVKEIRAMSRATQGVTLINLDKGEKLISLEK
VAETDNEEE
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtttgccaaggaaaccctcccggtcagtctcgaggaggagatgcggcgttca
tacctcgattatgcgatgagcgtgatcgtcggccgtgcactccccgacgtgcgcgacggg
ctcaagcccgtgcaccgtcgtgtgctgtacgcgatgaacgagcttggcaacgactggaac
aaggcttacaagaagtcggcgcgcgtcgtcggcgacgtcatcggtaaataccacccgcac
ggcgacacggccgtctacgacaccatggtccgcatggcgcaggacttctcgctgcgctac
ccgctgatcgacggccagggcaacttcggctcggtcgacggcgacaacgccgcggcgatg
cgttacaccgaagtgcgcatggcgcggatcgcgcacgagttgctggccgacctcgacaag
gaaacagtcgacttcggccccaactacgacggctccgagcaggagccgctcgtgctgccg
accaagattccgaatctgctgatcaacggttcgtcgggcatcgcggtcggcatggcgacg
aacatcccgccgcacaatctcaccgacatctgcaacgccctgttcgcgctgctcgacgcc
cccgcgaccgacatcgagtcgctgatcagcatcgtccaggcgcccgactttccgaccgcc
ggcatcatctacggcctttccggcgtgcgcgacggctaccgtaccggtcgcggccgcgtc
gtcatgcgtgcgacctgccacgtcgaggacctcgacaagagcggcggcaagcaggcgatc
atcatcgacgagctgccctatcaggtgaacaaggccaatctgctgatccggatcggcgaa
ctcgtgcgcgacaagcagatcgacggcatcgccgacctgcgcgacgagtccgacaagtcg
ggcatgcgcgtctacatcgaactcaagcgcggcgagaacgccgacgtggtcctgaacaat
ctgtacaagcagacacagatgcaggacaccttcggcatgaacatggtcgcgctgatcgac
gggcagccgcggctcctgaacctcaaggagatgctcgacgccttcctgcgccaccgccgt
gaagtcgtcacccggcgcaccgtcttcgatctcaggaaggcacgcgagcgcggccacatc
ctcgagggcctggcggtcgcgctcgccaacgtcgacgagatcgtcgagttgatcaagtcg
tcggaaacgcctgcgatcgcgaaggaacgcctgctcggccgcgcgtggaagtcggcgatg
gtcgaggagatgctcgcgcgcatcgaccccgaatattcgcggccggtgaacatggggccg
gaattcggcctgcacgccgatggctatcacctctcggaaatccaggcgcagcgcatcctc
gaaatgcagttgcagcgcctgaccaacctcgagtcggacaagatcctcgccgagtacaag
gaaatcatggcgaagatcgccgacctgctcgacattctggcgaatccggcgcgcatcacc
cagatcatccgcgaggaactgacccaggtccgcgaccagttcggcgatgggcggcgctcg
accatcgtcgagaacgcgcaggacatgtcgatggaagacctgatcaagcccgaggagatg
gtcgtcacgctgtcacacggcggctacatgaagtcgcagccgctggatgattaccgagca
cagaagcgcggcggccgcggcaagcaggcggcggggaccaaggacgaggacttcatcgag
aagatgttcgtcgccaacacccacgactacatcctctgcttctccaaccgcgggcggctg
tactggctcaaggtctacaacgtgccacagggcggacgcgccgcccgcggcaagccgatc
gtcaacctgctaccgctcgaggacggcgagaagatcagcgcgctcttgccggtcaagacc
ttcgacgacgagcactacgtgttcatggcgaccgccaacggcatcgtcaagaagacgccg
ctttccgaattctcgcgcccgcgcacggccggcatcatcgcggtcggcctcgacgacggc
gatgtgctgtgcggtgcgtcgatcaccgacggtcgtcacgacgtgatgctgttctccgat
tccggcaaggccgtgcgcttcgacgagaacgacgtgcgcccgatgggccgtgccgcgcgc
ggcgtgatcggcatgaagctcgccaagggcgccaagctgatctcgttgctcgtggctgaa
gacgagaacgacttcgtgctcacggcgaccgaaaacggctacggcaagcggacgccgatc
gcggaatacacgcgtcacgcgcgggccacgcaaggcatgatcgcgatccagaccagcgag
cgcaacggcaaggtcgtcgcggccaacctcgtcaaggcggacgacgaaatcatgctgatc
acgaccggcggcgtgctgatccgcacgcgcgtcaaggagatccgcgcgatgagccgggcg
acccagggcgtcacgctgatcaatctggacaagggcgaaaagctcatcagcctggaaaaa
gtagccgagaccgacaacgaagaggaatga

DBGET integrated database retrieval system