KEGG   Thiobacillus denitrificans: Tbd_1140Help
Entry
Tbd_1140          CDS       T00275                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbd_1140 (tpiA)
   01230 Biosynthesis of amino acids
    Tbd_1140 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbd_1140 (tpiA)
   00051 Fructose and mannose metabolism
    Tbd_1140 (tpiA)
   00562 Inositol phosphate metabolism
    Tbd_1140 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tbd_1140 (tpiA)
Enzymes [BR:tbd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tbd_1140 (tpiA)
Exosome [BR:tbd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tbd_1140 (tpiA)
  Exosomal proteins of bladder cancer cells
   Tbd_1140 (tpiA)
  Exosomal proteins of melanoma cells
   Tbd_1140 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1195661..1196407
Genome map
AA seq 248 aa AA seqDB search
MRKKLVAGNWKMHGSLAENAALLAALKPALQGIEAAVCVPFPYLAQVQTALAGSSLAWGA
QNVSEHGKGAFTGEVSASMLLDFGCKYVIVGHSERRSLYGESDALVAAKYMAAQAAGLTP
ILCVGESLAERESGVTEQVVARQLDAVVAAAGIASLARAVVAYEPVWAIGTGKTASPEQA
QAVHAFIRGKLADLDAAVAAGLIIQYGGSVKAANAAELMAQPDIDGGLIGGASLLADEFV
AICRAAAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagaagctcgtagccggtaactggaaaatgcacggcagcctcgccgagaacgcg
gcgctgctcgccgcgctcaaacccgctctgcaggggatcgaggctgcggtctgcgtgccg
tttccctatctggcacaggtgcagaccgcgctggcaggctcgtcgcttgcgtggggcgca
caaaacgtttccgagcatggcaagggtgcatttaccggtgaagtgtcggcgtcaatgctg
ctcgatttcggctgcaagtacgtcatcgtcggccattccgagcggcgcagcctctatggc
gagtcggacgcgctcgtggccgcgaaatacatggctgcgcaggccgccgggctcacgccg
atcctctgcgtcggcgaatcgctcgccgagcgtgagtcgggcgtcaccgagcaggtcgtc
gcgcgccagctcgacgccgtggtcgccgccgccggcatcgcatcgttggcccgggcggtc
gtcgcgtacgagcccgtctgggcgatcggaacgggcaagaccgcgagccccgaacaggcg
caggccgtgcacgcgttcattcgcggcaagctcgccgacctcgatgctgcggtcgcagcc
ggcctgatcattcagtatgggggtagcgtaaaggccgcaaatgcggcagaattgatggct
cagccggatatcgacggcgggctgatcggcggcgcctcgctgcttgccgatgagttcgtg
gcaatctgtcgggcggctgccaaataa

DBGET integrated database retrieval system