KEGG   Thiobacillus denitrificans: Tbd_1174Help
Entry
Tbd_1174          CDS       T00275                                 

Definition
bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
tbd  Thiobacillus denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tbd_1174
Enzymes [BR:tbd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tbd_1174
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     Tbd_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1229093..1234240
Genome map
AA seq 1715 aa AA seqDB search
MSTLLDQACERCGILPEYYDIWGGAHPTSEAAKRALLEAMGVPAASDADLARSLDELERR
EWSRALPPVVVVREPERPYRVPLVVAEADLGAGRRWKLRQESGGEIAGEFSPAALEEVAR
VTFDGVAYTRRTLVLAIEPGLGYHRFVVERADGGGEACEMSFIVAPPACYQPPAIHGDGR
AWGIAAQLYGVRSERNWGIGDFGDLRHMLEFCADSGAGSVLLNPLHAMFPDAPEHASPYS
PSNRAYFNTLYLDVEEITDFGECEAVRAVVHAPHFQARLRALRAADQVDYRGVADAKAEV
LRELYAHFRAEHLARESARGREFRAFQAAHGNSLRSQALFEALQTHFRNEDGAVWGWPVW
PEAYRTREAPEVSAFGEANLEQVEYFEYLQWQASLQLRAAGTRSWELGLGVGVMLDLAIG
VAEGGAATWMCRDLYAFGASAGAPPDEFNRLGQDWGLPPWIPHRLKARAYEPFIELIRAN
MRDSGALRLDHVMGLFRLFWVARGLPISQGAYVAYPFRDLLGILALESQRNRCLVVGEDL
GTVPEEVRAVLQPMEVLSTRLLYFERQENGRLAPPGSYPANAVAAVTTHDLPTLAGYWRG
LDIDLREQLRLFPDAEVRNQQVIARSEDRAQLLVALEGEQVLPPGGVQPVAFPELTTELA
VAVYTYLGRAPSKLLLLQLEDGFGVHEQPNLPGTVSPTYPCWRLKIPINLEEWRSSEPLQ
GIMQALRQERPVTQVAGPAGAGMEEGVRLWIPRATYRLQLNRDFKLPQAMALLPYLDALG
ISHCYLSPILKARPGSRHGYDITDHSSLNPEIASAEDFEQFVAEIKRRGMGQIMDLVPNH
MGINGADNAWWLDVLENGPASRYATYFDIDWYSNTADMSGRVLLPVLGEHYGAVLDKGEL
KLVFDPEDGAFSVFYYEHRFPVDPREYPRILGHGLERLQARLGAEDIVLLEFQALVTTFG
HLPARDRVTPEAVAERSRDKEVHKHRLAALYAGSADVARFIDENLAEFNGIGQAGANFDL
LHELLQSQAYRLAFWRVAADEINYRRFFDINDLAALRMDNPEVFEATHRLLHELLGRGYI
NGLRIDHPDGLYAPKAYFERLQAMAATLMPKVGNGHAESTPRPLYLIVEKILAVHEHLPE
SWAVHGTTGYDFAAACTGLFVDASAADAFTRTYQGFIRARPAYEEMVRANKHLIMQTSLA
GELQVLATQLTRLAKEDRCTCDFTLNSLRSAIAEIVASFPVYRTYVTPGETSADDVRYVD
WAVGVAKKRSRADPSIFDFVRDAMLGRLGRVDRDDYREAVAAFAMKFQQYSSPVTAKAVE
DTTFYQYNRLVALNEVGAEPQRFGVSLAAFHRENQERSRRWPHAMLASSTHDTKRSEDVR
ARLCVLSEVPELWHQALSRWSNLNRSKRRRLGESRVPSRNDEYLLYQTLLGIWPFDAPDA
DTLASLAARLRTYMLKAVREGKTHSSWISPDTAYEDAVGDFVSALLSADAGNLFLRDFAP
FQAGVARAGAFNSLSQLLLKLASPGVPDVYQGCEMWDFSLVDPDNRRPVDYARRQRALQA
VRTMHAEQGAAACTEALLARLQDGEIKLYLVWRLLAFRRAYEALFREGDYVPLKVHGARA
EQICAFSRQAGGDALVLVVPRLIARLVWESDALLVGEAVWGDTWIELPPERVRPGWVDVL
TERGVDTRGFGDSTGLSVAETLATVPFAVLHAAPA
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctgctcgatcaggcctgcgaacgctgcgggatactgccggagtactacgac
atatggggtggggcgcatccgaccagcgaggcggcgaagcgcgccttgctcgaggcgatg
ggtgtccccgcggcgagcgacgcggatctcgcgcgctcgctcgacgaactcgagcggcgc
gagtggtcgcgcgcgctgccgcccgtggtcgtcgttcgcgagcctgaacgcccgtatcgc
gtgccgctcgtcgtcgcggaggcggacttgggagccggcaggcgctggaagctgcgccag
gagtcggggggcgagatcgctggcgagttttccccggccgcactcgaagaggtggcgcgt
gtcacgttcgatggcgtcgcctacacgcggcggacgctcgtactcgcgatcgaacccggc
ctgggatatcaccgcttcgtggtcgagcgcgcggatgggggcggcgaggcctgcgagatg
tcattcatcgtcgcgccgccggcctgttaccagccgccggcgattcacggcgacgggcgc
gcctggggcatcgccgcgcagctctatggcgtgcgatccgaacgcaactggggcatcggc
gacttcggcgacctgcggcacatgctcgaattctgcgcagacagcggtgcgggctcggtg
ctgctcaatccgttgcatgcgatgtttccggacgcgcccgagcacgcgagcccctacagt
ccgtccaatcgcgcgtatttcaacacgctgtatctcgacgtcgaggagatcaccgatttc
ggcgagtgcgaggcggtgcgcgcggtcgtccacgcgccgcattttcaggcgcggctgcgt
gccctgcgcgctgccgatcaagtcgactaccgcggcgtcgccgacgccaaggccgaggtg
ctgcgcgagctctacgcgcatttccgcgccgagcacctggcgcgcgagagtgcgcgaggg
cgggaattccgggcgttccaggcggcccacggcaacagcctgcgcagtcaggccctgttc
gaggcgctgcagacccatttccgcaacgaggatggcgcagtctggggctggccggtgtgg
ccggaggcctaccgcacgcgcgaagcgcccgaggtctccgcgttcggcgaggccaacctc
gagcaggtcgagtatttcgaatacctgcaatggcaggcgtcgctgcagttgcgggctgcc
ggtacgcggtcgtgggagctcgggctcggcgtcggcgtgatgctcgacctcgcgatcggc
gtcgccgagggcggggcggccacctggatgtgccgcgacctctacgcgttcggcgcgagc
gcgggcgcgccgcccgatgaattcaaccggctggggcaggactggggcctgccgccgtgg
attccgcaccggctcaaggcgcgcgcctacgagcctttcatcgaactgatccgcgccaac
atgcgcgattcaggcgcgctgcggctcgaccacgtgatggggctcttccgcctgttctgg
gtggcgcgcgggctgccgatcagccaaggcgcctacgtcgcctatccgtttcgcgacctg
ctcggcatcctcgcgctcgagagtcagcgcaaccgctgtctcgtcgtcggcgaggacctc
ggcaccgtgccggaggaagtgcgggccgtgctgcagccgatggaagtcctctcgacccgg
ctgctctatttcgagcgccaggaaaacggccggctcgcgccgcccggttcctatccggcg
aacgcggtcgccgcggttacgacccacgacctgccgacgcttgccggctactggcgcgga
ctcgatatcgacctgcgcgaacagctgcgtctctttcccgacgccgaggtgcgcaaccag
caggtcatcgcgcgttcggaagatcgcgcccagctgctcgtcgcgctcgaaggcgagcag
gtgttgccgcccggcggcgtccagccggtggcctttcccgagttgacgaccgaactcgcg
gtcgcggtctacacctacctcgggcgcgcgccgtcgaagctgctgctgctgcaactcgaa
gacggcttcggggtgcacgagcagcccaacctgcctggcaccgtgtcgccgacttatccg
tgctggcgactcaagattcccatcaacctcgaggagtggcgcagcagcgaacccttgcag
ggcatcatgcaggcgctgcgccaggagcggccggtgacccaggtcgcggggccggccggg
gccgggatggaggagggcgtacgtctgtggatcccgcgggcgacctatcggctgcagctg
aatcgcgatttcaagctgccgcaggcaatggcgctgctgccgtatctcgacgcgctcggc
atcagccactgttacctctcgccgatcctcaaggcgcggcccggcagccgccacggctac
gacatcaccgaccacagcagcctgaaccccgagatcgcgagcgccgaggacttcgagcag
ttcgtcgccgaaatcaagcgccgcggcatggggcagatcatggatctggtgcctaaccac
atgggcatcaacggcgcggacaacgcgtggtggctcgacgtgctggagaacgggccggcc
tcgcgctacgccacctacttcgacatcgactggtattcgaacacggccgacatgtcgggg
cgcgtcctgctgcccgtgctcggcgagcattacggcgcggtactcgacaagggcgaactc
aagctcgtgttcgaccccgaggacggcgcgttcagcgtcttctactacgagcatcgcttt
ccggtcgacccacgcgaatacccgcgcattctcggacacgggctcgagcggctgcaggcg
cggctcggcgcggaggacatcgtgctgctcgagttccaggcgctggtcacgaccttcggc
cacctgccggcgcgcgaccgcgtcacgcccgaagccgtcgccgagcgcagccgcgacaag
gaagtgcacaagcatcgcctggccgcgctctatgccggcagtgccgacgtcgcgcgcttc
atcgacgagaatctcgcggaattcaacggcatcgggcaggccggcgcgaacttcgacctg
ctgcacgaactgctgcagagccaggcctaccgcctcgcgttctggcgcgtcgccgcagac
gagatcaactaccgccgcttcttcgacatcaacgatctggcggcactgcgcatggacaac
cccgaggtgttcgaggcgacgcatcgcctgctgcacgagctgctcgggcgcggctacatc
aacggcctgcgtatcgaccacccggacggcctctacgcgccaaaggcctacttcgaacgc
ctgcaggccatggccgcgacgctgatgccgaaagtcggcaacggccatgccgagagcacg
ccgcgcccgctttacctcatcgtcgagaagattctcgcggtgcacgagcaccttccggaa
tcgtgggcggttcacggcacgacgggctacgactttgcggcggcatgcaccgggctcttt
gtcgacgccagtgccgcggacgcgttcacgcgcacctaccagggcttcattcgcgcacgc
cccgcttacgaagaaatggtccgcgcgaacaagcatctgatcatgcagacctcgctcgcg
ggcgagctgcaggtgctcgcgacccagctcacgcggctggcgaaggaggaccgctgcacc
tgcgatttcacgctcaacagcctgcgcagcgcgatcgccgagatcgtcgcgagtttcccc
gtttaccggacctacgtcacgccgggcgagacgtcggccgacgatgtgcgctacgtcgat
tgggcagtcggcgtcgccaagaaacgcagccgcgccgatccgagcattttcgatttcgtg
cgcgacgcgatgctcgggcgcctcggccgggtcgatcgcgacgactaccgcgaggcggtc
gccgcgttcgcgatgaagttccagcaatacagcagcccggtgacggccaaggcggtcgag
gatacgaccttctatcagtacaaccggctcgtggcgctcaacgaggtcggcgccgagcca
cagcgcttcggcgtctcgctcgcggccttccatcgcgagaaccaggaacgatcccggcgc
tggccgcatgcgatgctcgcgagttcgacgcacgataccaagcgctcggaagacgtgcgg
gcgcggctgtgcgtgctgtcggaagtccccgaactgtggcatcaggccttgtcgcgctgg
agcaacctcaaccgcagcaaacggcgccggctcggcgaatcgcgcgtgccgagccgcaac
gacgaatacctgctataccagaccctgctcggcatctggccgttcgatgcgcccgacgcc
gacacgctcgccagcctggcggcgcgcctgcggacctacatgctgaaggccgtgcgcgag
ggcaagacccacagctcgtggatcagccccgacacggcgtacgaagacgcggtcggcgac
ttcgtcagcgcgctgctgtcggcggacgcaggcaacctgttcctgcgcgacttcgcgccc
ttccaggccggcgtcgcgcgtgccggcgcgttcaacagcctgtcgcaactgctgctcaag
ctcgcctcgccgggcgtgcccgacgtttatcaggggtgcgagatgtgggatttcagtctg
gtcgaccccgacaaccggcgaccggtcgactacgcacggcgccagcgtgcgctgcaggcg
gtcaggacgatgcacgcggaacagggcgcggccgcctgcacggaagccttgctcgcgcgc
ctgcaggacggcgagatcaagctttatctcgtctggcggctgctcgcatttcggcgtgcg
tacgaagccctgttccgcgagggcgactatgtcccgctcaaggtccacggtgcgcgcgcc
gagcagatttgtgccttctcccgtcaggcgggaggcgacgcgctggtgctcgtggttccg
cggctcatcgcacgcctggtgtgggagagcgacgcgctgctggtcggtgaagcggtgtgg
ggagacacctggatcgaactgccgccggagcgggtgcgtccgggttgggtcgacgtgctg
accgaacgcggcgtcgatacgcgtggcttcggtgattcgaccggattgtcggtcgcggag
acgctggcgacagttccgtttgccgtcctgcacgccgcgcctgcctag

DBGET integrated database retrieval system