KEGG   Thiobacillus denitrificans: Tbd_1189Help
Entry
Tbd_1189          CDS       T00275                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tbd  Thiobacillus denitrificans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbd_1189
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tbd_1189
  Amino acid metabolism
   00310 Lysine degradation
    Tbd_1189
Enzymes [BR:tbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tbd_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1249919..1251058
Genome map
AA seq 379 aa AA seqDB search
MKFEVRVPTLSDSVASGTLLPWRKAVGDTVARDETLVDLETDKVILEIPAPASGTLVEVR
AVGGAEVRADEVIALIETGEAAAAGARENATPAAPAPAPPAATAPARAAAPAESPSVAAP
PPRVATATAPQPRVAPPPARAAAQPGESRREPMSRLRQRVAERLVAAQHTAAMLTTFNEV
NMQPVNELRQRFKADFEVRHGVKLGYMSFFVRAVCRALEAFPIVNARIDGNDIVWHGDAD
IGIAISSPRGLVVPILRRAQQLSSDEIERAIADFARRARDSKLALEELAGGTFSITNGGV
FGSLLSTPILNPPQSAILGMHTIQERPVAEHGQVVIRPMMYLALTYDHRLIDGRDAVQFL
VAVKAALEAPDAPLPEYRA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaagtacgcgtgcccacgctgtcggattcggtcgccagcggcacgcttttg
ccgtggcgcaaggcggtcggcgacacggtcgcgcgcgacgagacgctggtcgatctcgag
accgacaaggtcatcctcgaaatccccgcgccggcctcaggcacgctggtcgaggtgcgc
gcggtggggggcgccgaagtcagggcggacgaagtcattgccctgatcgagactggcgag
gccgccgcggcgggcgcgcgcgaaaacgcgacgcctgccgcgcccgcgccggcgcccccg
gccgcgactgcgcccgctcgggccgcagcgccggcggagtctccgtcagtggcggcgccg
cctccccgcgtggcgacggccaccgcgccgcagccgcgggtcgccccgcctccggcccgt
gccgccgcgcagccgggcgagagccgtcgcgagccgatgtcgcgtctgcgccagcgcgtg
gccgagcgcctcgtcgcggcacagcacacggcggccatgctcaccacgttcaacgaagtg
aacatgcaacccgtgaacgaattgcgccagcgcttcaaggccgacttcgaggtccgccac
ggcgtcaagctcggctacatgtcgttcttcgtgcgtgcggtctgccgggcgctcgaagcc
ttcccgatcgtcaacgcgcggatcgacggcaatgacatcgtgtggcatggcgacgccgac
atcggcatcgcgatttcgagcccgcgcggactcgtcgtgcccatcctgcgccgcgcgcag
cagctctcgtcggacgaaatcgaacgcgcgatcgccgacttcgcgcggcgcgcacgcgac
agcaagctcgcgctcgaggagctcgccggcgggacgttctcgatcacgaacggcggcgtg
ttcggctcgctgctctcgaccccgatcctcaatccgccgcagtcggcgattctcggcatg
cacacgatccaggaaaggccggtcgccgagcatggccaggtcgtgatccggcccatgatg
tatctcgcgctgacctacgaccaccggctgatcgacggccgcgacgcggtgcagttcctg
gtcgcggtcaaggcggcgctcgaagcgcccgacgcgccgctgccggaataccgcgcatga

DBGET integrated database retrieval system