KEGG   Thiobacillus denitrificans: Tbd_1189Help
Entry
Tbd_1189          CDS       T00275                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tbd  Thiobacillus denitrificans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbd_1189
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tbd_1189
  Amino acid metabolism
   00310 Lysine degradation
    Tbd_1189
Enzymes [BR:tbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tbd_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1249919..1251058
Genome map
AA seq 379 aa AA seqDB search
MKFEVRVPTLSDSVASGTLLPWRKAVGDTVARDETLVDLETDKVILEIPAPASGTLVEVR
AVGGAEVRADEVIALIETGEAAAAGARENATPAAPAPAPPAATAPARAAAPAESPSVAAP
PPRVATATAPQPRVAPPPARAAAQPGESRREPMSRLRQRVAERLVAAQHTAAMLTTFNEV
NMQPVNELRQRFKADFEVRHGVKLGYMSFFVRAVCRALEAFPIVNARIDGNDIVWHGDAD
IGIAISSPRGLVVPILRRAQQLSSDEIERAIADFARRARDSKLALEELAGGTFSITNGGV
FGSLLSTPILNPPQSAILGMHTIQERPVAEHGQVVIRPMMYLALTYDHRLIDGRDAVQFL
VAVKAALEAPDAPLPEYRA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaagtacgcgtgcccacgctgtcggattcggtcgccagcggcacgcttttg
ccgtggcgcaaggcggtcggcgacacggtcgcgcgcgacgagacgctggtcgatctcgag
accgacaaggtcatcctcgaaatccccgcgccggcctcaggcacgctggtcgaggtgcgc
gcggtggggggcgccgaagtcagggcggacgaagtcattgccctgatcgagactggcgag
gccgccgcggcgggcgcgcgcgaaaacgcgacgcctgccgcgcccgcgccggcgcccccg
gccgcgactgcgcccgctcgggccgcagcgccggcggagtctccgtcagtggcggcgccg
cctccccgcgtggcgacggccaccgcgccgcagccgcgggtcgccccgcctccggcccgt
gccgccgcgcagccgggcgagagccgtcgcgagccgatgtcgcgtctgcgccagcgcgtg
gccgagcgcctcgtcgcggcacagcacacggcggccatgctcaccacgttcaacgaagtg
aacatgcaacccgtgaacgaattgcgccagcgcttcaaggccgacttcgaggtccgccac
ggcgtcaagctcggctacatgtcgttcttcgtgcgtgcggtctgccgggcgctcgaagcc
ttcccgatcgtcaacgcgcggatcgacggcaatgacatcgtgtggcatggcgacgccgac
atcggcatcgcgatttcgagcccgcgcggactcgtcgtgcccatcctgcgccgcgcgcag
cagctctcgtcggacgaaatcgaacgcgcgatcgccgacttcgcgcggcgcgcacgcgac
agcaagctcgcgctcgaggagctcgccggcgggacgttctcgatcacgaacggcggcgtg
ttcggctcgctgctctcgaccccgatcctcaatccgccgcagtcggcgattctcggcatg
cacacgatccaggaaaggccggtcgccgagcatggccaggtcgtgatccggcccatgatg
tatctcgcgctgacctacgaccaccggctgatcgacggccgcgacgcggtgcagttcctg
gtcgcggtcaaggcggcgctcgaagcgcccgacgcgccgctgccggaataccgcgcatga

DBGET integrated database retrieval system