KEGG   Thiobacillus denitrificans: Tbd_1271Help
Entry
Tbd_1271          CDS       T00275                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00300  Lysine biosynthesis
tbd01100  Metabolic pathways
tbd01120  Microbial metabolism in diverse environments
tbd01230  Biosynthesis of amino acids
Module
tbd_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tbd_1271
Enzymes [BR:tbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tbd_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AAZ97224
JGI: Tbd1271
UniProt: Q3SJE0
Position
complement(1336981..1338159)
Genome map
AA seq 392 aa AA seqDB search
MANETLEDAVLASETLALAVELLKRRSVTPDDAGCHDLIAARLQALGFHIERHRHNDVDN
LWARRGTASPVVCFAGHTDVVPPGPLEQWLSDPFEPTLRDGKLYARGAADMKTSDAAFVT
ATERFLARRPDHPGSIAFLLTSDEEGPATDGTVRVVEALKARGELLDYCIVGEPTSAAEF
GDTIKNGRRGSLSGTLRVKGVQGHIAYPHLAKNPIHLAAPAIAELAETMWDEGNSYFPPT
TWQISNIHAGTGVTNVIPGMVEIQFNFRFSTASTAEGLMDAVNEILDSHGLDYEIDWNLS
GKPFLTPRGALCDRLSEAVHEVTGLTPELSTTGGTSDGRFIADICREVVEFGPLNMSIHK
LNEHVALENVEQLAAVYEKALEKLLGESDERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgaaacgctcgaggatgccgtccttgccagtgaaaccttggcgctcgcggtc
gaactgctcaagcgccgctcggtcacgcccgacgacgccggctgccacgacctgatcgcg
gcgcggctgcaagcgcttggcttccacatcgagcgccatcgccacaacgacgtcgacaat
ctgtgggcgcgtcgcggcacggcctccccggtcgtgtgcttcgccggccataccgacgtc
gtcccgcccgggccgctcgagcagtggctctccgatcctttcgagccgacgctgcgcgac
ggcaagctctacgcccgcggcgccgccgacatgaaaacctcggatgcggccttcgtcact
gcgaccgagcgcttcctcgcccgccgtcccgaccatccgggctcgatcgctttcctgctg
acttccgacgaggaaggtccggcgaccgacggcacggtgcgcgtcgtcgaagcgctcaag
gcacgcggcgaactgctcgactattgcatcgtcggcgagccgacgagcgccgccgaattc
ggcgacacgatcaagaacggacggcgcggctcgctctcgggcaccctgcgcgtgaagggt
gtacaggggcacatcgcctacccccacctcgcgaaaaacccgatccatctcgcggcgccg
gcgatcgccgagctcgccgagacgatgtgggacgaaggcaatagctacttcccgccgacg
acctggcagatttccaacatccatgccggcaccggcgtcaccaacgtgattccgggcatg
gtcgagatccagttcaatttccgcttttccacggccagcacggccgagggcctgatggac
gccgtcaacgaaatcctcgacagccacggcctcgactacgaaatcgactggaacctctcc
ggcaagccctttctcacgccgcgcggcgccttgtgcgacaggctctccgaagccgtccac
gaggtcaccgggctcacgcccgagctttcgaccacgggcggcacgtcggacggccgcttc
atcgccgacatctgtcgcgaagtcgtcgagttcggcccgctcaacatgagcatccacaag
ctgaacgagcacgtcgcactcgaaaacgtcgagcagctcgcagcggtttacgagaaggcg
ctggaaaagctgctgggcgagagcgatgaacgcgtttga

DBGET integrated database retrieval system