KEGG   Thiobacillus denitrificans: Tbd_1502Help
Entry
Tbd_1502          CDS       T00275                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tbd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tbd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tbd00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tbd00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tbd00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tbd00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tbd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1592154..1593410)
Genome map
AA seq 418 aa AA seqDB search
MAKKMNAFYAQSGGVTAVINASACGVIETARKNKDKIGKVYAGRNGIIGALTEDLIDTSK
ESDAAIAALRSTPSGAFGSCRFKLKSLEANKREYERLIEVFKAHNIGYFFYNGGGDSADT
CFKVSQLSEAMGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASYDVRSMAK
TSTKVFVIEVMGRHAGWIAAAGGLVEDHGIPVVILFPEIEFDQKKFLALVDKKVKEFGFC
TVVVSEGCHYPDGKFLAEQGTRDAFGHAQLGGAAPVVANMIKDALGHKFHWAVADYLQRA
ARHIASKTDVKQAYELGKKAVELAIRGHNSVMPTVDRLSDKPYKYKIGVADLKDVANVEK
FMPRDFITKDGFGITDKCKRYLTPLIQGEDYPKYKDGLPVYVTLKNVAVAKKLAEFKL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaaatgaacgccttctacgcgcagtccggcggcgtcaccgccgtcatcaac
gcgtcggcctgcggcgtgatcgagaccgcgcgcaagaacaaggacaagattggcaaggtc
tacgccggccgcaacggcatcatcggcgcgctgaccgaagacctcatcgacaccagcaag
gaatccgacgccgcgatcgcggcgctgcgctcgacgccgtcgggcgccttcggctcgtgc
cgcttcaagctcaagtcgctcgaagccaacaagcgcgaatacgaacgcctgatcgaggtg
ttcaaggcgcacaacatcggctacttcttctataacggcggcggcgattcggcggatacc
tgcttcaaggtcagccagctgtccgaagcgatgggctatccgatccaggcgatccacgtg
ccgaagaccgtcgacaacgacctgccgatcaccgactgctgcccgggcttcggctcggtc
gccaaatacatcgccgtgtcgacgctcgaagcgagctacgacgtgcgctcgatggccaag
acctcgaccaaggtcttcgtgatcgaggtcatgggccgccacgccggctggatcgcggca
gcgggcggtctcgtcgaggaccacggcattccggtcgtgatcctgttccccgaaatcgaa
ttcgatcagaagaaattcctcgcgctcgtcgacaagaaggtcaaggaattcggcttctgc
accgtcgtcgtgtccgaaggctgccactacccggatggcaagttcctcgccgaacagggc
acgcgcgacgccttcggccacgcccagctcggcggcgcggcgccggtcgtcgccaacatg
atcaaggatgcgctcggccacaagttccactgggccgtcgccgattacctgcagcgcgcc
gcgcgccacatcgcctcgaaaacggacgtcaagcaggcctatgagctcggcaagaaagcc
gtcgaactcgcgatccgcggccacaactcggtcatgccgaccgtcgaccggctctccgac
aagccctacaaatacaagatcggcgtagccgatctcaaggatgtcgccaacgtcgagaaa
ttcatgccgcgcgacttcatcaccaaggacggcttcggcatcaccgacaagtgcaagcgt
tacctcacgccgctcatccagggcgaggactatccgaagtacaaggacggcttgccggtc
tacgtgacgctcaagaacgtcgcggtggccaagaagctggcggaattcaagctctag

DBGET integrated database retrieval system