KEGG   Thiobacillus denitrificans: Tbd_1502Help
Entry
Tbd_1502          CDS       T00275                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbd_1502
   01230 Biosynthesis of amino acids
    Tbd_1502
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbd_1502
   00030 Pentose phosphate pathway
    Tbd_1502
   00051 Fructose and mannose metabolism
    Tbd_1502
   00052 Galactose metabolism
    Tbd_1502
  Energy metabolism
   00680 Methane metabolism
    Tbd_1502
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tbd_1502
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tbd_1502
Protein phosphatases and associated proteins [BR:tbd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tbd_1502
Messenger RNA biogenesis [BR:tbd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tbd_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1592154..1593410)
Genome map
AA seq 418 aa AA seqDB search
MAKKMNAFYAQSGGVTAVINASACGVIETARKNKDKIGKVYAGRNGIIGALTEDLIDTSK
ESDAAIAALRSTPSGAFGSCRFKLKSLEANKREYERLIEVFKAHNIGYFFYNGGGDSADT
CFKVSQLSEAMGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASYDVRSMAK
TSTKVFVIEVMGRHAGWIAAAGGLVEDHGIPVVILFPEIEFDQKKFLALVDKKVKEFGFC
TVVVSEGCHYPDGKFLAEQGTRDAFGHAQLGGAAPVVANMIKDALGHKFHWAVADYLQRA
ARHIASKTDVKQAYELGKKAVELAIRGHNSVMPTVDRLSDKPYKYKIGVADLKDVANVEK
FMPRDFITKDGFGITDKCKRYLTPLIQGEDYPKYKDGLPVYVTLKNVAVAKKLAEFKL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaaatgaacgccttctacgcgcagtccggcggcgtcaccgccgtcatcaac
gcgtcggcctgcggcgtgatcgagaccgcgcgcaagaacaaggacaagattggcaaggtc
tacgccggccgcaacggcatcatcggcgcgctgaccgaagacctcatcgacaccagcaag
gaatccgacgccgcgatcgcggcgctgcgctcgacgccgtcgggcgccttcggctcgtgc
cgcttcaagctcaagtcgctcgaagccaacaagcgcgaatacgaacgcctgatcgaggtg
ttcaaggcgcacaacatcggctacttcttctataacggcggcggcgattcggcggatacc
tgcttcaaggtcagccagctgtccgaagcgatgggctatccgatccaggcgatccacgtg
ccgaagaccgtcgacaacgacctgccgatcaccgactgctgcccgggcttcggctcggtc
gccaaatacatcgccgtgtcgacgctcgaagcgagctacgacgtgcgctcgatggccaag
acctcgaccaaggtcttcgtgatcgaggtcatgggccgccacgccggctggatcgcggca
gcgggcggtctcgtcgaggaccacggcattccggtcgtgatcctgttccccgaaatcgaa
ttcgatcagaagaaattcctcgcgctcgtcgacaagaaggtcaaggaattcggcttctgc
accgtcgtcgtgtccgaaggctgccactacccggatggcaagttcctcgccgaacagggc
acgcgcgacgccttcggccacgcccagctcggcggcgcggcgccggtcgtcgccaacatg
atcaaggatgcgctcggccacaagttccactgggccgtcgccgattacctgcagcgcgcc
gcgcgccacatcgcctcgaaaacggacgtcaagcaggcctatgagctcggcaagaaagcc
gtcgaactcgcgatccgcggccacaactcggtcatgccgaccgtcgaccggctctccgac
aagccctacaaatacaagatcggcgtagccgatctcaaggatgtcgccaacgtcgagaaa
ttcatgccgcgcgacttcatcaccaaggacggcttcggcatcaccgacaagtgcaagcgt
tacctcacgccgctcatccagggcgaggactatccgaagtacaaggacggcttgccggtc
tacgtgacgctcaagaacgtcgcggtggccaagaagctggcggaattcaagctctag

DBGET integrated database retrieval system