KEGG   Thiobacillus denitrificans: Tbd_1502Help
Entry
Tbd_1502          CDS       T00275                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00010  Glycolysis / Gluconeogenesis
tbd00030  Pentose phosphate pathway
tbd00051  Fructose and mannose metabolism
tbd00052  Galactose metabolism
tbd00680  Methane metabolism
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01120  Microbial metabolism in diverse environments
tbd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbd_1502
   00030 Pentose phosphate pathway
    Tbd_1502
   00051 Fructose and mannose metabolism
    Tbd_1502
   00052 Galactose metabolism
    Tbd_1502
  Energy metabolism
   00680 Methane metabolism
    Tbd_1502
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tbd_1502
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tbd_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AAZ97455
JGI: Tbd1502
UniProt: Q3SIS0
Position
complement(1592154..1593410)
Genome map
AA seq 418 aa AA seqDB search
MAKKMNAFYAQSGGVTAVINASACGVIETARKNKDKIGKVYAGRNGIIGALTEDLIDTSK
ESDAAIAALRSTPSGAFGSCRFKLKSLEANKREYERLIEVFKAHNIGYFFYNGGGDSADT
CFKVSQLSEAMGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASYDVRSMAK
TSTKVFVIEVMGRHAGWIAAAGGLVEDHGIPVVILFPEIEFDQKKFLALVDKKVKEFGFC
TVVVSEGCHYPDGKFLAEQGTRDAFGHAQLGGAAPVVANMIKDALGHKFHWAVADYLQRA
ARHIASKTDVKQAYELGKKAVELAIRGHNSVMPTVDRLSDKPYKYKIGVADLKDVANVEK
FMPRDFITKDGFGITDKCKRYLTPLIQGEDYPKYKDGLPVYVTLKNVAVAKKLAEFKL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaaaatgaacgccttctacgcgcagtccggcggcgtcaccgccgtcatcaac
gcgtcggcctgcggcgtgatcgagaccgcgcgcaagaacaaggacaagattggcaaggtc
tacgccggccgcaacggcatcatcggcgcgctgaccgaagacctcatcgacaccagcaag
gaatccgacgccgcgatcgcggcgctgcgctcgacgccgtcgggcgccttcggctcgtgc
cgcttcaagctcaagtcgctcgaagccaacaagcgcgaatacgaacgcctgatcgaggtg
ttcaaggcgcacaacatcggctacttcttctataacggcggcggcgattcggcggatacc
tgcttcaaggtcagccagctgtccgaagcgatgggctatccgatccaggcgatccacgtg
ccgaagaccgtcgacaacgacctgccgatcaccgactgctgcccgggcttcggctcggtc
gccaaatacatcgccgtgtcgacgctcgaagcgagctacgacgtgcgctcgatggccaag
acctcgaccaaggtcttcgtgatcgaggtcatgggccgccacgccggctggatcgcggca
gcgggcggtctcgtcgaggaccacggcattccggtcgtgatcctgttccccgaaatcgaa
ttcgatcagaagaaattcctcgcgctcgtcgacaagaaggtcaaggaattcggcttctgc
accgtcgtcgtgtccgaaggctgccactacccggatggcaagttcctcgccgaacagggc
acgcgcgacgccttcggccacgcccagctcggcggcgcggcgccggtcgtcgccaacatg
atcaaggatgcgctcggccacaagttccactgggccgtcgccgattacctgcagcgcgcc
gcgcgccacatcgcctcgaaaacggacgtcaagcaggcctatgagctcggcaagaaagcc
gtcgaactcgcgatccgcggccacaactcggtcatgccgaccgtcgaccggctctccgac
aagccctacaaatacaagatcggcgtagccgatctcaaggatgtcgccaacgtcgagaaa
ttcatgccgcgcgacttcatcaccaaggacggcttcggcatcaccgacaagtgcaagcgt
tacctcacgccgctcatccagggcgaggactatccgaagtacaaggacggcttgccggtc
tacgtgacgctcaagaacgtcgcggtggccaagaagctggcggaattcaagctctag

DBGET integrated database retrieval system