KEGG   Thiobacillus denitrificans: Tbd_1913Help
Entry
Tbd_1913          CDS       T00275                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbd_1913
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbd_1913
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbd_1913
Enzymes [BR:tbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tbd_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2008892..2009713)
Genome map
AA seq 273 aa AA seqDB search
MSRIGQTFTALKAQNRKALISFITAGDPGKGLTVPLMHALVDAGTDIIELGVPFSDPMAD
GPVIQRASERALANKVGLKDVLAMTAEFRKVNTSTPVVLMGYANPFEHMGYETFAEAAKT
AGVDGVLTVDIPPEESLGVSDVFKAHDLDPIFLLSPTTPESRVAQVAAVAGGFIYYVSLK
GVTGSANLDTEEVARKVAMVRKHCDLPVGVGFGIRDAATAEAVARIADAVVVGSRIVNEI
ETAPEGECGARVKHLVADLRRGVDAASKQTENK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcggccagacgttcaccgcgctcaaggcgcaaaacaggaaagccctgatt
tccttcatcacggccggcgatcccggcaagggtctgaccgtgccgctcatgcatgcgctc
gtcgacgccggcaccgacatcatcgagctcggcgtgccgttttccgaccccatggccgac
ggtccggtgatccagcgcgcgtcggaacgggcgctcgcgaacaaggtcgggctcaaggac
gtgctggcgatgaccgccgagttccgcaaggtcaacaccagcacgcccgtcgtcctgatg
ggttacgccaacccgtttgagcacatgggttacgagacctttgccgaggccgcgaagacc
gcgggcgtcgacggtgtgctgaccgtcgacattccgcccgaggaatcgctcggcgtgtcc
gacgtgttcaaggcccacgacctggacccgattttcctgctgtcgccgaccacgcccgag
tcgcgtgttgcgcaggtagccgcggtcgccggcggcttcatctattacgtgtcgctcaag
ggggtgaccggctcggccaacctcgacaccgaggaggtcgcgcgcaaggtggcgatggtg
cgtaagcattgtgacttgccggtcggcgtcggtttcggcatccgcgacgcggccactgcc
gaagccgtcgcgcgcattgccgatgcggtcgtggtggggagccgcattgtcaacgagatc
gagaccgcgcccgagggagaatgcggcgcgcgggtcaagcatctggtcgccgacctgcgc
cgcggcgtcgacgccgcatcgaagcaaacggagaataaataa

DBGET integrated database retrieval system