KEGG   Thiobacillus denitrificans: Tbd_1914Help
Entry
Tbd_1914          CDS       T00275                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tbd  Thiobacillus denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbd_1914
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbd_1914
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbd_1914
Enzymes [BR:tbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tbd_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2009757..2010956)
Genome map
AA seq 399 aa AA seqDB search
MKLTDLPDSRGHFGPYGGIFVSETLMAALDALRVEYDAACRDPGFMAEFEYELKHYVGRP
SPVYHARRLSEEYGGAQIYLKREDLNHTGAHKINNTIGQALLARRMGKKRVIAETGAGQH
GVASATVAARYGMECVVYMGAEDVARQAPNVFRMKLLGATVVPVSSGSKTLKDALNEAMR
DWVTNVESTFYILGTAAGPHPYPMLVRDFQCVIGRECIAQMPELVGRQPDAVVACVGGGS
NAIGIFHPYIPHENVRLIGVEAGGSGVASGKHAAPLTAGTPGVLHGFRSYLMQDENGQII
ETHSVSAGLDYPGVGPEHSYLKDAGRAEYVPINDDEALAAFHDLCRFEGIIPALESSHAV
AQAKKLAPTMKKDQVILVNLSGRGDKDINTVAKAAGITL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgactgaccttcccgattcccgcggccacttcggtccctacggcggcattttc
gtttccgaaacgctgatggccgcgctcgacgcgctgcgtgtcgaatacgacgcggcgtgc
cgggaccccggcttcatggccgaattcgagtacgaactcaagcactacgtcgggcggccg
agcccggtctaccacgcccggcggctttcggaggaatacggcggcgcgcagatctacctc
aagcgcgaggatctcaaccacaccggcgcgcacaagatcaacaacacgatcggccaggcg
ctgctcgcgcgccgcatgggcaagaagcgcgtcatcgccgagaccggcgcgggccagcac
ggcgtcgcgtcggcgaccgtcgccgcgcgctacggcatggaatgcgttgtctacatgggc
gccgaagacgtcgcgcgacaggcccccaacgtctttcgtatgaagctcctcggcgcgacc
gtcgtgcccgtgtcgtcgggttcgaagacgctgaaggacgcgctgaacgaagcgatgcgc
gactgggtgacgaacgtcgagtcgaccttctacatcctcggcaccgcggccggcccgcat
ccctacccgatgctcgtgcgcgacttccagtgcgtgatcgggcgcgaatgcatcgcgcag
atgcccgagctcgtcggacgccagcccgacgcggtcgtcgcctgcgtcggcggcggctcg
aacgcgatcggaattttccatccctacattccccatgagaacgtgcgcctgatcggtgtc
gaagccggcggttcgggggtcgcgagcggcaagcacgctgcgccgctgaccgccggcacg
cccggggtgttgcacggctttcgcagctacctgatgcaggacgagaacggccagatcatc
gagacccattcggtctcggccggcctcgactatccgggcgtcggccccgagcacagctat
ctcaaggacgccggtcgcgccgaatacgtgccgatcaacgacgacgaagcgctcgccgcc
ttccacgatctgtgccgcttcgagggcatcatccccgcgctcgagtcgagccacgcggtg
gcgcaggcgaagaaactcgcgccgacgatgaagaaggaccaggtcattctggtgaacctc
tcggggcgcggcgacaaggacatcaacaccgtggcgaaggcggcgggcatcacgctctga

DBGET integrated database retrieval system