KEGG   Thiobacillus denitrificans: Tbd_2058Help
Entry
Tbd_2058          CDS       T00275                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tbd  Thiobacillus denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tbd_2058
Enzymes [BR:tbd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Tbd_2058
Exosome [BR:tbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tbd_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2146690..2148912)
Genome map
AA seq 740 aa AA seqDB search
MRKLVEATQAGSEASVALAPSAPIQRLQAGLHHDPFEVLGVHVQPDGSKLVRAFLPAAEA
VEVAGVRMTRVPGTDCFERLLPPGTALEAHPLLTWQDKRSGAWQRLRSPYSFAPQLGEMD
LYLFGEGRHFEIWKVLGARVKTVDGVTGCLFAVWAPAVLRVSVVGDFNDWDGRRHPMRCR
GVSGVWELFIPGLEAGHAYKYEILGRHGERVTKTDPYARQMFLRPETTSRVPDERPYAWG
DAEWLAARTRFDWQHRPMSVYEVHPGSWRRRADGSFYSWRELTAELIPYVRDLGYTHIEL
LPVAEHPFDASWGYQVSGYYAATARFGSPDDLRAFVDACHQAGLGVLLDWVPGHFPKDDF
ALARFTGEPLYEHADPRRGEHQDWGTLVFDFGRNEVRNFLVANALYWLEEFHIDGLRVDA
VASMLYLDYSRRHGEWLPNQHGGRENLEAIHFLHEVNAEVHARFPGAITIAEESTAWPAV
SRPIELGGLGFSMKWNMGWMNDTLDYIEKEPVYRKYQHNQLTFSQMYAWSENFVLPLSHD
EVVHLKKSLLDKMPGDRWQRFANLRLLYAWQYAHPGKKLLFMGGEFGQWNEWREAGQLDW
VLLGFPEHDGIRALLRDLNRLYRDEAALHFWDFDPRGFRWIDCHDADQSVLSLVREGPDG
APPIVVLLNFTPVPRHGYRIGVPRAGAWCEVLNSDSMYYGGSNLGNGKPLYPAAVPWMGF
GQSIEVTLPPLGAIFLKPCP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagctagtcgaggccacgcaggccggcagtgaagcgtccgtggcgctcgcgccg
agcgcgccgatccagcgtctgcaggccggcctgcaccacgatcccttcgaggtgctcggc
gtgcacgtccagcccgacggcagcaagctcgtccgcgccttcctgcccgccgccgaggcg
gtcgaagtcgccggcgtgcgcatgacgcgcgtgcccggcaccgattgtttcgagcgtcta
ttgccgcccgggacggcgctcgaagcgcatccgctgctgacctggcaggacaagcgcagc
ggcgcctggcagcgcctgcgctcgccctacagcttcgcgccgcaactcggcgagatggat
ttgtatctgttcggcgagggtcgccatttcgagatctggaaggtgctcggtgcgcgcgtg
aagaccgtcgacggcgtcaccggctgtctgttcgcggtgtgggcgccggccgtgctgcgc
gtcagcgtcgtcggcgacttcaacgactgggacggccggcgccatccgatgcgctgtcgc
ggcgtctcgggggtctgggagctgttcatccccgggctggaggcggggcacgcctacaaa
tacgaaatcctcggccgccacggcgagcgcgtgaccaagaccgatccctacgcgcggcag
atgttcctgcgccccgaaacgaccagccgcgtgcccgacgagcgcccctacgcctggggc
gacgccgagtggcttgccgcgcgcacgcgcttcgactggcagcaccggccgatgagcgtc
tacgaagtccatcccggttcgtggcgccgccgcgccgacggcagcttctacagctggcgc
gaactcacggccgagctgattccctatgtgcgcgatctgggctacacccacatcgaattg
ctgccggtcgccgagcatccgttcgacgcctcgtggggctaccaggtctcgggttactac
gcagcgacggcgcgcttcggctcgcccgacgacctgcgcgccttcgtcgacgcgtgccac
caggccgggctcggcgtgctgctcgactgggtgccggggcatttccccaaggacgatttc
gcgctcgcccgcttcaccggcgagccgctctatgaacatgccgacccgcgccgcggcgag
catcaggactggggcacgctggtcttcgatttcggccgcaatgaggtgcgcaatttcctc
gtcgccaatgcgctctactggctcgaggagtttcacatcgacggtctcagggtcgatgcg
gtcgcgtcgatgctctacctcgactattcgcggcgccacggcgaatggctgccgaaccag
cacggcggacgcgagaacctcgaggcgatccatttcctgcacgaggtcaacgccgaggtc
cacgcgcgttttccgggggcgatcacgatcgctgaggagtcgacggcgtggccggcggtg
tcgcggccgatcgagctcggcggcctcggcttctcgatgaaatggaacatggggtggatg
aacgacacgctcgactacatcgagaaggagccggtctaccgcaagtatcagcataaccag
ctgaccttcagccagatgtacgcgtggagcgagaatttcgtgctgccgctgtcgcacgac
gaggtcgtgcacctgaagaaaagcctgctcgacaagatgccgggcgaccgctggcagcgc
ttcgccaatctgcgtctgctctacgcctggcagtatgcgcatccgggcaagaagctgctc
ttcatgggcggcgaattcggccagtggaacgagtggcgcgaagcgggacagctcgactgg
gtcctgctcggctttcccgagcacgacggcatccgcgcgctgctgcgcgacctcaaccgg
ctctaccgcgacgaggcggcgctgcacttctgggatttcgacccgcgcggcttccgctgg
atcgactgtcacgacgccgaccagtcggtgctgagcctcgtccgcgagggacccgacggc
gcgccgccgatcgtcgtcctgctcaatttcacgccggtgccgcggcacggctatcgcatc
ggcgtgccccgcgcgggcgcgtggtgcgaggtgctgaacagcgattcgatgtactacggc
ggcagcaacctcggcaacggcaagcccttgtatcccgccgccgtgccttggatgggcttc
gggcagtcgatcgaagtgacgctgccgccgctcggggcgattttcctcaagccctgtccc
tga

DBGET integrated database retrieval system