KEGG   Thiobacillus denitrificans: Tbd_2138Help
Entry
Tbd_2138          CDS       T00275                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00010  Glycolysis / Gluconeogenesis
tbd00030  Pentose phosphate pathway
tbd00051  Fructose and mannose metabolism
tbd00052  Galactose metabolism
tbd00230  Purine metabolism
tbd00500  Starch and sucrose metabolism
tbd00520  Amino sugar and nucleotide sugar metabolism
tbd00521  Streptomycin biosynthesis
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01120  Microbial metabolism in diverse environments
tbd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbd_2138
   00030 Pentose phosphate pathway
    Tbd_2138
   00051 Fructose and mannose metabolism
    Tbd_2138
   00052 Galactose metabolism
    Tbd_2138
   00500 Starch and sucrose metabolism
    Tbd_2138
   00520 Amino sugar and nucleotide sugar metabolism
    Tbd_2138
  Nucleotide metabolism
   00230 Purine metabolism
    Tbd_2138
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tbd_2138
Enzymes [BR:tbd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tbd_2138
    5.4.2.8  phosphomannomutase
     Tbd_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAZ98091
JGI: Tbd2138
UniProt: Q3SH02
Position
2223562..2224935
Genome map
AA seq 457 aa AA seqDB search
MEYPKEIFKAYDIRGIVGKTFTPEIVEAIGHAIGSEAAARGQKEICIGRDGRLSGPDLAA
ALARGIRKAGIGVVDLGMVATPMTYFAAYQLGTNSAVMVTGSHNPPDYNGLKMVLGGETL
SGATIQALRQRLVDGNLAHGEGGYREHDIAGEYLARIVSDVKLARPMKIIVDCGNGVPGA
FVPKLYRDMGCEVEELFCEVDGNFPNHHPDPSQPKNLQDLISALKTSDAEIGLAFDGDGD
RLGVVTKDGSIIFPDRQLMLFADDVLSRNPGAEIIFDVKSTRKLFDWIRARGGKPTLWKT
GHSFIKAKMKETGALLAGEMSGHVFFKERWFGFDDGLYAGARLLEYLSKQADINATLHGL
PDTVNTPELNIKMAEGEHYALMERLQKTAKFPDAQEVITLDGLRVEYADGFGLARPSNTT
PVVVLRFEADNTQALERIQADFRRVIHEAAPSLSLPF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggaataccccaaggaaatcttcaaggcctacgacattcgcggcatcgtcggcaagacc
ttcacgcctgaaatcgtcgaggccatcggtcatgccatcggctcggaagccgccgcccgc
ggccagaaggaaatctgcatcggccgcgacggccgtctctcggggcccgatctcgccgct
gcgctggcgcgcggcatccgcaaggccggcatcggcgtggtcgacctcggcatggtcgcg
acgccgatgacttacttcgccgcctaccagctcggcacgaacagcgcagtaatggtcacc
ggcagccataatccgcccgactacaacggcctgaaaatggtgctcggcggcgagacgctc
tccggcgccacgatccaggcgctgcgccagcgcctcgtcgacggcaatcttgcccacggc
gaaggcggctaccgcgagcatgacatcgcgggcgagtatctcgcgcgcatcgtctccgac
gtcaagctcgcgcgtccgatgaagatcatcgtcgactgcggcaacggcgtgcccggcgcg
ttcgtgcccaagctctaccgcgacatgggatgcgaggtcgaggaactcttctgcgaggtc
gacggcaacttccccaatcaccaccccgacccttctcagccgaaaaacctgcaggacctg
atttctgcactgaagacgagcgacgccgagatcggcctcgccttcgacggcgacggcgac
cgccttggcgtcgtcaccaaggacggcagcatcatcttccccgaccgccagctgatgctg
ttcgccgacgacgtgctgagccgcaatccaggcgccgaaatcattttcgacgtgaaatcg
acgcgcaagctgttcgactggatccgcgcgcgcggcggcaaacccacgctgtggaaaacc
ggccacagcttcatcaaggccaagatgaaggagaccggcgcgctgctcgccggcgaaatg
tcgggccacgtgttcttcaaggaacgctggttcggcttcgacgacggcctctatgccggg
gcacgcctgctcgaatacctgtcgaagcaggccgacatcaacgccacgctgcacggcctg
cccgacaccgtgaacacgcccgaactcaacatcaagatggccgagggcgagcactacgcg
ctgatggagcggctgcagaaaaccgcgaaattccccgacgcgcaggaagtcatcacgctc
gacggcctgcgcgtcgaatacgccgacggcttcggcctcgcccgcccgtccaacaccacg
ccggtcgtcgtgctgcgcttcgaagccgacaatacccaggcactcgagcgcatacaggcc
gacttccggcgcgtcatccacgaggccgcaccgtcgctcagccttccgttttga

DBGET integrated database retrieval system