KEGG   Thiobacillus denitrificans: Tbd_2213Help
Entry
Tbd_2213          CDS       T00275                                 

Definition
DNA recombination protein, RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tbd  Thiobacillus denitrificans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tbd_2213
Enzymes [BR:tbd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tbd_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2292230..2292805)
Genome map
AA seq 191 aa AA seqDB search
MIGRITGTLAAKQPPQVLVDVNGVCYEIDVPMSTFYNLPGIGEKVALLTHLAIREDAHLL
YGFGSEVERAAFRELLKVSGIGAKTALSVLSGLSVNDLSAAIAAQEIGRIVKVPGIGKKT
AERLLLELKGKPVFAGALASVPSAGASDDVRQALLALGYNERETAATVRELPAGLAVGEA
IRQALRALSRA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgattggccgcatcactggcacgctcgccgcgaagcagccgccgcaggtgctcgtcgac
gtcaatggcgtctgctacgagatcgacgtgccgatgagcaccttctacaacctgccgggc
atcggcgagaaggtcgcgctgctcacgcatctggcgatacgcgaggacgcgcacctgttg
tacggcttcggcagcgaggtcgaacgcgcggcgtttcgcgaactcctcaaggtttccggc
atcggtgcgaagacggcgctgtcggtgctgtcgggactctcggtgaacgacctctctgcc
gcgatcgcggcgcaggaaatcggccgcatcgtcaaggtgccgggcatcggcaagaagacc
gccgagcgcctgctgctcgaactgaagggcaagcccgtgttcgccggcgccctggccagc
gtgccgtccgccggcgcgtccgacgacgtgcgccaggcgctgcttgcgctcggttacaac
gagcgcgagacggccgcgaccgtgcgcgagctccccgccggtctggcggtcggcgaggcc
atccgccaggcgctgcgcgccctgtcgcgggcctga

DBGET integrated database retrieval system