KEGG   Thiobacillus denitrificans: Tbd_2222Help
Entry
Tbd_2222          CDS       T00275                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tbd  Thiobacillus denitrificans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbd_2222
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbd_2222
Enzymes [BR:tbd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tbd_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2301966..2302754)
Genome map
AA seq 262 aa AA seqDB search
MSDILEKILATKRAEVAAGLARVPLAEMRARAEAAAPARDFVGALRAKRDAGRPAVIAEI
KKASPSKGVIRADFRPAEIAASYEKGGAACLSILTDAEYFQGSADYLKAARAACTLPVLR
KDFMIDAYQVYEARAMGADCILLIVAALELPAMQALEALANELGMAVLVESHDAAELDAA
LTLRTPLQGINNRNLRTFEVSLDTTLSLLPKIGPERIVVTESGILAPADVDTMRSRGVNT
FLVGEAFMRAADPGAELARLFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacatcctcgaaaaaatcctcgcgaccaaacgcgccgaggtcgcggccggcctc
gcccgggtgccgctcgccgaaatgcgcgcgcgtgccgaggcggccgcgccggcacgcgat
ttcgtcggcgcgctgcgggcaaagcgcgatgccggccggccggccgtgatcgcagagatc
aagaaggcaagtccgtccaagggcgtgatccgggccgacttccggcccgcggaaatcgcc
gccagttatgaaaagggcggcgcggcatgtctgtccatactgaccgacgcggaatatttc
cagggcagcgcggactacctcaaggccgcacgcgcggcctgtacgcttccggtcctgcgc
aaggatttcatgatcgacgcctaccaggtctacgaggcgcgcgcgatgggcgccgactgc
atcctgctgatcgtcgccgcgctcgagttgccggcgatgcaggcgctcgaagcgctggcg
aatgaattggggatggcggttctcgtggagtcgcacgacgccgccgaactcgacgccgcg
ctgacgctgcgcacgccgctgcagggcatcaacaaccgcaacctgcgcaccttcgaggtc
agcctcgataccacgctttcgctgctgccgaagataggccccgagcgcatcgtcgtcacc
gagtccggcatcctcgcgccggccgacgtggatacgatgcgcagccgcggcgtcaatacc
tttctggtcggcgaggccttcatgcgtgcggccgacccgggcgccgagcttgccaggctg
tttgcctga

DBGET integrated database retrieval system