KEGG   Thiobacillus denitrificans: Tbd_2331Help
Entry
Tbd_2331          CDS       T00275                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tbd  Thiobacillus denitrificans
Brite
Enzymes [BR:tbd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tbd_2331
Secretion system [BR:tbd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Tbd_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2404727..2405437)
Genome map
AA seq 236 aa AA seqDB search
MKFTSLALAASLMFAAAAHADEKLIRKTLAQQFPGAKVSSVKPTPYSGLFEVYLDGQLVY
VDAKAKYVFAGDVIDLKNRTNLTQARLNQLQAVSWDVFPLNNALKTVKGNGARKLVLFSD
VDCPYCRKFEAELTKVDNITVYTFLYPIAGLHPKAVQTSKQIWCAPDRNKAWDAYITRGT
VPDNDGKCANPVDATIALGNRLKVNGTPTLFFANGVRVPGMVPAAQLERLLAANAK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacttccctggcgctggctgcaagcctgatgttcgccgcagccgcccacgcc
gacgagaagctgatccgcaagaccctggcacagcagttcccgggtgcgaaggtcagttcg
gtcaagccgacgccttacagcggcctgttcgaggtctacctcgacggccagctcgtctac
gtcgacgcgaaggcgaaatacgtcttcgcgggcgacgtgatcgacctgaagaatcgcacg
aacctgacgcaggcgcgactcaaccagttgcaggccgtgagttgggacgtgtttccgctc
aacaacgcgctgaagaccgtgaaaggcaacggcgcgcgcaagctggtgctgttctctgac
gtcgattgcccgtattgccgcaagttcgaggctgaactcaccaaggtcgacaacatcacc
gtctacactttcctctacccgatcgccgggctgcacccgaaggccgtccagacgtcgaag
cagatctggtgtgcgcccgaccgcaacaaggcctgggacgcctacatcacgcgcggcacc
gtgcccgacaacgacggcaagtgcgccaacccggtcgacgccacgatcgccctcggcaac
cggttgaaagtaaacggcacgccaacgctgttcttcgccaacggcgtgcgcgtgcccggc
atggtgcccgccgcgcaactcgagcgactgcttgccgccaacgcgaagtga

DBGET integrated database retrieval system