KEGG   Thiobacillus denitrificans: Tbd_2368Help
Entry
Tbd_2368          CDS       T00275                                 

Definition
type 4 prepilin peptidase 1 (EC:3.4.23.43)
Orthology
K02654  
leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
tbd  Thiobacillus denitrificans
Brite
Enzymes [BR:tbd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Tbd_2368
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     Tbd_2368
Peptidases [BR:tbd01002]
 Aspartic Peptidases
  Family A24: type IV prepilin peptidase family
   Tbd_2368
Secretion system [BR:tbd02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Tbd_2368
  Type IVa pilus homolog protein
   Tbd_2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2441941..2442792)
Genome map
AA seq 283 aa AA seqDB search
MTLFVAEPALFTGLVFLLGLLVGSFLNVVVHRLPKMMDAEWQAQCAELRGEPSPAGPRFN
LWAPRSACPACGHAITALENVPLLSWLWLRGRCASCRTPISARYPLVELLAALLSAAVAW
KWGPTVQAAGALLLVWMLIALAFIDLDTTLLPDSLTLPLLWAGLLINLGGHFASLPDAVA
GAAAGYLVLWSVYWMFKLVTGKEGMGYGDFKLLAAIGAWLGWQLLPVTLLLASVVGAVVG
ITMIVAVKHDRRVPIPFGPYLAGGGLVALFFGADLTQAYLAQF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacgctattcgtcgccgaaccggccctcttcacagggctggttttcctgctcggcctg
ctcgtcggcagctttctcaacgtcgtcgtccaccgcctgccgaaaatgatggacgccgaa
tggcaggcgcagtgcgcggagctgcgcggcgagccgtcgccggcggggccgcgtttcaac
ctgtgggcgccgcgctcggcgtgcccggcctgcggccacgcgatcacggcgctcgagaac
gtaccgctgctttcgtggctatggcttcgcggacggtgcgcgtcttgcaggacgccgatc
agcgcgcgctatccgctggtcgaactgctcgcggcgctgctctccgcggcggtggcctgg
aagtgggggccgacggtccaggccgccggtgcattgctgctcgtctggatgctcatcgcg
ctcgccttcatcgatcttgacacgacgttgttgccggacagcctgacgcttccactgctc
tgggccggcttgctgatcaatctcggcggacatttcgcttcccttcctgacgcggtcgcc
ggcgcggccgcgggctacctcgtgctatggtcggtctactggatgttcaagctggtgacg
ggcaaggaggggatgggctatggtgatttcaagctgctggcggcgatcggggcgtggctc
ggctggcagttgctgcccgtcacgcttctgctcgcgtcggtcgtcggggcggtggtcggc
atcacgatgatcgtcgccgtcaagcacgaccgccgtgtgccgatcccgttcggcccctac
ctcgcgggcgggggactcgttgccctgttcttcggtgcggacctgacgcaggcctatctc
gcgcagttctga

DBGET integrated database retrieval system