KEGG   Thiobacillus denitrificans: Tbd_2368Help
Entry
Tbd_2368          CDS       T00275                                 

Definition
type 4 prepilin peptidase 1 (EC:3.4.23.43)
Orthology
K02654  
leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
tbd  Thiobacillus denitrificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2441941..2442792)
Genome map
AA seq 283 aa AA seqDB search
MTLFVAEPALFTGLVFLLGLLVGSFLNVVVHRLPKMMDAEWQAQCAELRGEPSPAGPRFN
LWAPRSACPACGHAITALENVPLLSWLWLRGRCASCRTPISARYPLVELLAALLSAAVAW
KWGPTVQAAGALLLVWMLIALAFIDLDTTLLPDSLTLPLLWAGLLINLGGHFASLPDAVA
GAAAGYLVLWSVYWMFKLVTGKEGMGYGDFKLLAAIGAWLGWQLLPVTLLLASVVGAVVG
ITMIVAVKHDRRVPIPFGPYLAGGGLVALFFGADLTQAYLAQF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacgctattcgtcgccgaaccggccctcttcacagggctggttttcctgctcggcctg
ctcgtcggcagctttctcaacgtcgtcgtccaccgcctgccgaaaatgatggacgccgaa
tggcaggcgcagtgcgcggagctgcgcggcgagccgtcgccggcggggccgcgtttcaac
ctgtgggcgccgcgctcggcgtgcccggcctgcggccacgcgatcacggcgctcgagaac
gtaccgctgctttcgtggctatggcttcgcggacggtgcgcgtcttgcaggacgccgatc
agcgcgcgctatccgctggtcgaactgctcgcggcgctgctctccgcggcggtggcctgg
aagtgggggccgacggtccaggccgccggtgcattgctgctcgtctggatgctcatcgcg
ctcgccttcatcgatcttgacacgacgttgttgccggacagcctgacgcttccactgctc
tgggccggcttgctgatcaatctcggcggacatttcgcttcccttcctgacgcggtcgcc
ggcgcggccgcgggctacctcgtgctatggtcggtctactggatgttcaagctggtgacg
ggcaaggaggggatgggctatggtgatttcaagctgctggcggcgatcggggcgtggctc
ggctggcagttgctgcccgtcacgcttctgctcgcgtcggtcgtcggggcggtggtcggc
atcacgatgatcgtcgccgtcaagcacgaccgccgtgtgccgatcccgttcggcccctac
ctcgcgggcgggggactcgttgccctgttcttcggtgcggacctgacgcaggcctatctc
gcgcagttctga

DBGET integrated database retrieval system