KEGG   Thiobacillus denitrificans: Tbd_2567Help
Entry
Tbd_2567          CDS       T00275                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tbd  Thiobacillus denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tbd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2641432..2642190)
Genome map
AA seq 252 aa AA seqDB search
MTQPLAGRTILVTRAPRQAAALSAAIRAAGGSAFEFPALAFEAVPVDRLQASLAQVVAAD
FVIFVSPNAAEFGMAAIGSLAAGRSVLAVGPGTARALAAQGLDAVITPDGQDSEALLALP
QLLDVDGKRVVIVRGIGGRALLGDTLAARGAEVHYMECYRRLAPTADAAPLIARWQAGGI
DAVTVASAETLHNLAALLGEAGAPLLAHTPLFAPYEKIAAAARSFGVAQATATPGGDAGL
VAGLVNWFRNTA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcccctggccgggcgcacgatcctcgtcacccgcgcgccgcgccaggcggcc
gccttgagcgcggcgatccgcgcggccggcggcagcgcgttcgagttccccgcgctcgcc
ttcgaagccgtgccggtcgaccgcttgcaagcgtcgctcgcgcaggtcgtcgccgccgat
ttcgtgattttcgtcagcccgaatgcggcggaattcggcatggccgcgatcggcagcttg
gccgccgggcgcagcgtcctcgccgtcggtccgggaaccgcgcgcgccctcgcggcccaa
gggctcgatgccgtgatcacgcccgacggccaggacagcgaggccttgctcgcgctcccg
cagttgctcgacgtcgacggcaaacgcgtcgtcatcgtgcgcggcatcggcgggcgcgcg
ctcctgggcgacacgctcgccgcgcgcggcgccgaggtccattacatggagtgctaccgg
cgcctagcgccgacggccgatgcggcgccgctgatcgcgcgctggcaagccggcgggatc
gacgccgtcaccgtggcgagcgccgagacgctgcacaatctggccgcgctgcttggcgag
gccggggcgccgctgcttgcacatacgccgcttttcgcgccgtatgagaaaatcgccgcc
gctgcgcgcagcttcggtgtcgcccaggccacggcaacgcccggcggcgacgccggactc
gtcgcgggtctcgtcaactggttcaggaataccgcatga

DBGET integrated database retrieval system