KEGG   Thiobacillus denitrificans: Tbd_2594Help
Entry
Tbd_2594          CDS       T00275                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tbd  Thiobacillus denitrificans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tbd_2594
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tbd_2594
Enzymes [BR:tbd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Tbd_2594
Lipid biosynthesis proteins [BR:tbd01004]
 Desaturase
  First
   Tbd_2594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2669097..2670269)
Genome map
AA seq 390 aa AA seqDB search
MQSGLLDLPWWGLVLVTLGLTHVTIAAVTIYLHRSQAHRSVDLHPVVSHFFRFWLWLTSG
MVTREWVSIHRKHHAKCETPEDPHSPQTRGLKKVFWEGSELYRAEAKVAETLEKYSHGTP
DDWVERNVYSRHSAKGIFLMMAIDLALFGPIGLTIWAVQMAWIPITAAGIINGVGHYWGY
RNFACEDASTNILPWGILIGGEELHNNHHAYGTSARLSNKWYEFDIGWLYIKLMSYAGLA
TVRKVAPTVKWQAPKPLCDLDTLQAIITHRYDVMSRFVKSVRAESAAEIAKLRAGANLPQ
NWNFDSFRRWLHKEPAELAADDRAALDTLLGRSERLQTVYRMRQELAAIWGRSTASREQL
LEQLQAWCKRAEESGIQSLRDFSVRLRCYA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaggtttgttggatcttccctggtgggggctcgtgctggtgaccctgggtctg
acccacgtcaccatcgccgccgtcaccatctatctgcaccgttcgcaggcgcaccgttcg
gtcgacctgcatcccgtggtcagccatttcttccgcttctggctgtggctgacgtcgggc
atggtcacccgcgagtgggtctcgatccatcgcaagcaccacgccaagtgcgagaccccc
gaggacccgcacagcccgcagacgcgcggcctgaagaaagtgttctgggaaggctcggag
ctttaccgggccgaggccaaagtcgccgagacgctcgagaaatacagccacggcacgccc
gacgactgggtcgagcgcaacgtctacagccgccactcggccaagggcattttcctcatg
atggcgatcgacctcgccttgttcgggccgatcggcctgacgatctgggccgtacagatg
gcgtggatcccgatcaccgccgccggcatcatcaacggcgtcggccattactggggctac
cgcaacttcgcctgcgaggacgcgagcacgaacatcctgccgtggggcatcctgatcggc
ggcgaggaattgcacaacaatcaccacgcctacggcacctcggcgcggctgtcgaacaaa
tggtacgagttcgacatcggctggctctatatcaagctgatgtcgtacgcggggctcgcc
acggtgcgcaaggtcgcgccgacggtcaaatggcaggcgcccaagccgctctgcgatctc
gacaccctgcaggcgatcatcacccatcgctacgacgtcatgagccgcttcgtgaagagc
gtacgcgccgagagcgcggccgaaatcgccaagctcagggccggcgcgaacctgccgcaa
aactggaacttcgacagcttccgccgctggctgcacaaggagcccgccgagctcgcggcg
gacgacagggccgcgctcgacacgcttctcggccggagcgagcgcctgcagaccgtctac
cgcatgcgccaggagctggccgcgatctggggccgctcgaccgcgagccgcgagcaactg
ctcgagcagctgcaggcctggtgcaagcgcgccgaggagagcggcatccagtccttgcgg
gatttttcggtccgcctgcgctgttacgcttga

DBGET integrated database retrieval system