KEGG   Thiobacillus denitrificans: Tbd_2695Help
Entry
Tbd_2695          CDS       T00275                                 

Definition
protein-L-isoaspartate o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tbd  Thiobacillus denitrificans
Brite
Enzymes [BR:tbd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tbd_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2777332..2777985
Genome map
AA seq 217 aa AA seqDB search
MDIEQARYNMVEQQIRPWDVLNQDVLDLLLKVRREDFVPEAHRLLAFIDMEIPLGHGQTM
WTPKLEARVLQEVAIQPTDRVLEIGTGSGYLTALLASLAEEVVSVDILAEFTAQATQKLH
AHGFANVVLHTADAARDWDDGAGFDVIVLTGSTPLLSDAWRRRLRPGGRLFAIVGEPPVM
QARLITSTGPGATRSVTLFETCVAPLLNAPQPAAFVF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgagcaagcgcgctacaacatggtggaacaacagatccgtccctgggacgtg
ctcaatcaggacgtgctcgacctcctgctcaaggtgcgccgcgaagatttcgtgcccgag
gcacaccgcctgctcgccttcatcgatatggaaatcccgctcggccatggtcagaccatg
tggaccccgaagctcgaggcgcgcgtcctgcaggaagtcgcgatccagccgaccgaccgc
gtgctcgagatcggcaccggcagcggctacctgacggcgctgctcgcgagcctggccgaa
gaagtcgtgtcggtcgacatccttgccgagttcaccgcgcaggcgacgcagaaactgcac
gcccacggcttcgccaacgtcgttctgcacacggcggacgccgcccgcgactgggatgac
ggcgcgggtttcgacgtgatcgtgctgaccggctcgacgccgttgctctccgacgcgtgg
cgccgccgcctcaggccgggcgggcggctcttcgccatcgtcggtgagccgccggtgatg
caggcccggctcatcaccagcaccgggcccggtgcgacgcgcagcgtcacgctgttcgag
acctgcgtcgcaccgctgctcaacgcgccgcaaccggcggcattcgtgttttga

DBGET integrated database retrieval system