KEGG   Treponema brennaborense: Trebr_0052Help
Entry
Trebr_0052        CDS       T01489                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tbe  Treponema brennaborense
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tbe00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(61771..62409)
Genome map
AA seq 212 aa AA seqDB search
MLLEKERMDVMHYCRKLVSAGLTKGTGGNISIYNRDQNLVAISPSGMDYFEVELTDIPVV
SLDGAVVEGKRKPSSELKMHLIYYANREDISAVVHTHSPYCTVLATIREPLPASSYLVAF
AGKNVRCTDYRQFGTEALADVAFDGMKDRNAVLLANHGLIAGGESIAHAFTVAEEIEFCA
QIYVKSRAIGTPVILEDSEMISLIKKFKQYGQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttattggaaaaagaacggatggacgtcatgcattattgcagaaaactggtttctgcg
ggacttaccaaaggtaccggcgggaatatcagcatttacaacagggatcagaatctcgtc
gccatcagtccgagcggaatggattattttgaagtggaactgacggacattcccgtcgtt
tcactcgacggcgccgtcgttgaaggaaaacggaaaccgtcgagcgaactgaaaatgcat
ctcatttattacgcgaaccgtgaagatatttccgccgtcgttcacacgcattcgccgtac
tgcaccgtgctggcaacgatacgcgaaccgctgccggcttcaagttatttggtcgcgttc
gcgggaaaaaacgtccgctgcaccgactaccggcagttcggaacggaagcgctggccgac
gttgcgttcgacggcatgaaagaccggaacgccgtacttttggcgaatcacggactgatt
gccggcggtgaatcgatagcccatgcgttcaccgtggcagaagaaatcgaattctgcgca
cagatatacgtaaaatcgcgggctatcggtacgccggttattttggaagacagtgaaatg
atttcactgatcaagaaattcaaacagtacggtcagtga

DBGET integrated database retrieval system