KEGG   Treponema brennaborense: Trebr_0241Help
Entry
Trebr_0241        CDS       T01489                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tbe  Treponema brennaborense
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trebr_0241
Enzymes [BR:tbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Trebr_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(266833..268266)
Genome map
AA seq 477 aa AA seqDB search
MKGFKMPDGFLWGGATAANQCEGGWNMDGRGLANVDVVPFGKDRLPVVLGKLKMFDCDDA
HTYPSHTAVDMYHNYKEDIALFAEMGFTCYRLSIAWTRIFPNGDDAVPNEAGLAFYDNIF
DECRKHAIEPLVTLCHFDAPMHLIRKFGGWRDRKMTDCFERYCRTVFERYKNKVKYWLTF
NEINMILHAPFMGAGLYFTPDDNEELIKYTAAHHELVASAKAVKLAHEMIPDSRIGCMLA
AGQNYPYTCKPQDVWAALEADRKNWFFIDVQSRGAYPAYALNLFKRKDIRIPFEPEDEKI
LREGTVDFISFSYYFTNVAADAESPAERGGNGIFETIKNPYLKTSDWGWQIDPQGLRITM
NNLYDRYQKPLFIVENGLGTADTVPSDGPIRDDYRIEYMRSHILEMEKAVLEDGIPLLGY
TMWGPLDIVSASTGEMKKRYGLIYVDKDDNGKGSLARSPKKSFYWYKAVIQSNGEIL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatttaaaatgccggacggatttttatggggaggcgctacggccgcaaaccaa
tgtgaaggcggctggaatatggacggacgcggactcgcaaacgtagacgtagtaccgttc
ggaaaagaccggcttcccgtcgtactcggaaagctgaaaatgttcgattgtgatgacgca
cacacatatccgagccatacggcagtcgacatgtaccacaattataaggaagatatcgcg
ctatttgccgaaatgggctttacgtgttacaggctttcaatcgcatggacgcggatattt
ccgaacggagacgacgcagttcccaatgaagcgggacttgccttttacgacaacatattc
gacgaatgccggaaacacgctatagaaccgctcgtaacgttgtgccattttgacgcgccg
atgcatttgatacgaaaattcggcggctggcgagacagaaaaatgacagactgtttcgag
cggtactgccgcacggtgtttgaacgatacaaaaataaagtcaaatactggctcacgttc
aatgaaatcaatatgattctgcacgcgccgtttatgggagcgggcctttattttacaccg
gacgataacgaagaactcataaaatataccgccgcacatcacgaactcgttgcaagcgcg
aaagccgtcaaattggcacacgaaatgattcctgattcccgaatcggctgtatgctcgcc
gcgggtcagaattatccgtatacgtgcaaaccgcaggacgtatgggcggcattggaagcc
gaccgtaaaaactggtttttcatcgacgtccaaagccgcggcgcgtatcccgcatacgca
ctcaatctgttcaaacggaaagacatacggattccgtttgaaccggaggatgaaaaaata
ttgcgggaaggaaccgtagattttatcagcttcagttattatttcacgaacgtcgcggcg
gatgcggaaagtcccgctgaaagaggcgggaacggtatttttgaaacgataaaaaatccg
tatctcaaaacatccgattggggatggcagatagatccgcagggcttacgcataacgatg
aacaatttgtacgatcgctatcagaaaccgctttttatcgtagaaaacggactcggaaca
gccgacaccgtaccgagcgacggacccatacgggacgattaccgcatagaatacatgcgt
tcccacatcctcgaaatggaaaaggcagttctggaagacgggattccgcttctgggatac
accatgtgggggccgctcgacatcgtaagcgcttccaccggtgagatgaaaaaacgttac
ggacttatctacgtcgataaagacgataacggtaagggaagtctggcccgttcccctaaa
aaatcgttttattggtataaagcggtaatacagtcgaacggagagatattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system