KEGG   Treponema brennaborense: Trebr_0267Help
Entry
Trebr_0267        CDS       T01489                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tbe  Treponema brennaborense
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Trebr_0267
Enzymes [BR:tbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Trebr_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304079..305005
Genome map
AA seq 308 aa AA seqDB search
MKILNFGSINIDYVYRVTHFVRPGETLAADERSVFPGGKGLNQSVSLGRCCGTERDIFHA
GCIGRADADFIDALLRENRVSGMFVETCESVTGHTIIQVDENGQNCILLYSGANGAQSEA
HIARVFRRFGAGDYLVLQNEISCVAYILEQAHAAGMKIFFNPSPYTADIRKLPLEYVDCF
LLNEIEAGDLCGTHAADESVLLAKTAAAFPRAEIVLTLGKRGVVCKTDSAVYRYGTYDVP
VVDTTAAGDTFTGYFIGCRALGMDAPAALKYASAASSLAVSQRGAVPSIPRMHRVRDFAD
SAAVPSFN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactgaatttcgggtcgatcaatatcgactatgtgtaccgcgtaacgcacttc
gttcggcccggcgaaacgctcgccgcggacgaacgctccgtttttcccggtggaaaaggt
ctcaatcagtccgtctcgctcggccgctgctgcggaactgaacgtgatatttttcatgcc
ggatgtatcggtcgagccgacgccgattttatagacgctctgttgcgggaaaaccgtgtc
agcggcatgttcgtggaaacgtgcgaatcggttacgggacacacgattattcaagttgac
gaaaacgggcagaattgtattttattgtattcgggagcgaacggggcacagtcggaagcc
catatcgcccgcgttttccgccgattcggcgccggtgattacctggtgcttcagaacgaa
atatcgtgcgtcgcttatattctcgagcaggctcatgcggcgggaatgaagatttttttc
aacccgtcgccgtacaccgccgatatccggaaattaccgcttgaatacgtcgactgtttt
ctgctgaacgaaattgaagccggagatttgtgcggtacgcacgctgcggacgaatcggtt
ttgcttgcaaaaacggccgccgcgtttccgcgggcggaaatcgtgctgacgctgggaaag
cgcggcgtcgtctgcaaaactgattccgccgtttatcggtacggaacgtacgacgtaccg
gtcgtcgacacgacggcagcgggcgatacgtttaccggctattttatcggctgccgggcg
ctcggtatggacgcgccggctgcgttaaagtatgcgtcggccgcgtcgtcgcttgccgtt
tcgcagcgcggggcggtgccttcgattccccgaatgcatcgtgtccgtgattttgccgac
tccgccgccgttccttcctttaattga

DBGET integrated database retrieval system