KEGG   Treponema brennaborense: Trebr_0279Help
Entry
Trebr_0279        CDS       T01489                                 

Definition
phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tbe  Treponema brennaborense
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Trebr_0279
Enzymes [BR:tbe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Trebr_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319193..320539)
Genome map
AA seq 448 aa AA seqDB search
MYNYFEHRSLFKESTLAKTVYLGLTGDIIHPGIINIIAEAAKYGEVTIGLLTDSAIVNHK
RLPYLTYEQRKKVVENIKGVSKIVPQKEWSYVPNLIKYKPDYIIHGDDWKTGSMSKVREE
VYETMKRQGGQVIEIPYTKGIDSSALVENAKGIGTTPEIRMKTLRRLISAKPIVRIMEAH
SGLSGLIIENTEIEKEDGMHRFDGMWSSSLTDSTDKGKPDIEAVDLTTRLQSLTDILECT
TKPIIFDGDTGGLTEHFVFTVRTLERNGVSAVIIEDKVGLKKNSLFGTEAKQELAPAEEF
CRKISEGKKAQVTKDFMIIARLEELIAGHTVDEALERADLYVKAGADGVMIHSKEKTGAD
IKEFCQRFREMYKNVPIVLVPTTYNQFQEKELKEWGANVIIYANHMLRAAYPAMVKCAET
ILRTERSLEVNDICMPIKQILELIPGTK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtataattattttgaacacagatcactgttcaaggagtctacattggcaaaaacggtc
tatcttggtcttaccggcgatatcattcacccgggcattattaatattattgcggaagca
gctaaatacggagaggtcacgatcggccttcttaccgattcggctattgtcaatcacaaa
cggttaccgtatcttacgtatgaacaacgcaaaaaggtcgtagaaaatataaaaggcgtt
tcaaagatcgttccgcaaaaagaatggagttacgttccgaaccttatcaaatacaaaccc
gattacatcatacacggtgacgactggaaaacgggttccatgagtaaggtccgtgaagag
gtttatgaaacgatgaaacgacagggcggacaagtcattgaaattccctacacaaaggga
atcgattcttccgctctcgttgaaaatgccaaaggaatcggtacgacccccgaaatcaga
atgaaaacgctcagacggcttatttcggcaaaaccgattgtccgtattatggaagcacat
tcaggactttccggactgatcatcgaaaacacggaaattgaaaaagaagacggaatgcat
cggttcgacggcatgtggtcctcgtcacttaccgattctacggacaaaggcaaacccgac
attgaagctgtcgatttgacgacccgcctccaaagtcttaccgatattctcgaatgtacc
accaaacccatcatattcgacggagacaccggcggacttaccgaacacttcgtgtttacg
gtacggacgttggaacggaacggagtttcggcagtcattatcgaagataaagtcggtctc
aagaaaaattcattattcggaacggaggcaaaacaggaacttgcacctgcggaagaattc
tgccgtaaaataagcgaaggaaaaaaagctcaagttacgaaagactttatgattattgcc
cgactggaagaacttattgccggacacaccgtagatgaagcactcgaacgggccgatctg
tacgtcaaagccggagcggacggcgtcatgattcattcaaaagaaaaaacgggagcagac
ataaaggaattttgccaacgattccgtgaaatgtataaaaacgttcctatcgttctcgta
cccacaacgtacaatcagtttcaggagaaggaattaaaagagtggggtgcaaacgttatc
atatacgcaaaccacatgctgcgggcggcgtatcctgcaatggtaaaatgtgccgaaacc
attttacgtacggaacgctctttggaagtaaacgatatttgtatgccgatcaaacagatt
ctggaattgatcccgggtacgaaataa

DBGET integrated database retrieval system