KEGG   Treponema brennaborense: Trebr_0326Help
Entry
Trebr_0326        CDS       T01489                                 

Definition
Glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tbe  Treponema brennaborense
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Trebr_0326
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Trebr_0326
Enzymes [BR:tbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Trebr_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375883..377244
Genome map
AA seq 453 aa AA seqDB search
MIKRARVFETVPAECRFLQEAAEMPFIPEQKAEMNVISVFPEREYQEILGFGGAFTESAG
YVYAQLGAADKKRLIEAYFDPDKGIGYTLGRTHMNSCDFSLENYACYESEADYRAERFDP
SRTFKYTVPLMKAAFAHAESSGRSITLHAVPWSPPAFMKTNGNMNCGGSLKSEYRQAWAD
CFVRYIRALEREGIRTGIVSTQNEPAAVQRWDSCRYTAAEETAFVRDYLGPTLAAAGLGD
IKILVWDHNKESVLERSSAAFDDRVASEYVWGAGFHWYSGDHFEQLSLVHERYPHKALLL
TEFCVEERSDDGPQGNAEKYAHELIGDLNNFANGFIDWNLLLDEEGGPNHARNFCDAAVR
TRIRAGKTELEFRPAYYYMGHFSKFIFPCSRRIAVSRFSDKLETCAFKRPDGKLVLIVLN
RSDTAAESVISVPEYGIASASFKPHSIKTVVLP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagagcccgtgtttttgaaaccgttccggcggaatgccgttttcttcaggaa
gcggcggaaatgccgttcattccggaacaaaaagccgaaatgaacgttatcagcgtgttc
cccgaacgggaatatcaggaaatactcggattcggcggtgcgtttacggaatctgcggga
tatgtatacgcgcaattgggcgccgctgataaaaaacgtttgatagaagcgtattttgat
ccggataagggaatcggttatacgctgggacgcacgcatatgaacagctgcgatttttca
cttgaaaattacgcatgctacgagtcggaggccgattaccgtgcggaacgttttgatcct
tcccgtacttttaaatatacggttccgctcatgaaagctgcgttcgcacacgctgagtcg
tccggacgcagcataacgcttcacgccgttccgtggagcccgcccgcttttatgaagacg
aacggaaacatgaattgcggcggttcgttaaagagcgagtaccggcaggcgtgggcggat
tgcttcgtgcgttatatccgcgccttggaacgggaaggaatacggacgggcatcgtgtcg
acccaaaacgaacccgccgctgtccagcgatgggattcgtgccggtatacggctgcggaa
gaaacggctttcgtccgcgattacttggggccgacgcttgcggccgccggcttgggcgat
ataaaaatactcgtttgggatcataataaggaatccgttctggaacgttccagtgccgca
tttgatgaccgcgtcgcttccgaatacgtttggggcgccgggttccactggtattcgggt
gaccattttgagcagctttcgctcgtgcatgaacgttatccgcataaagcgctgctgctg
accgagttctgcgtggaagagcgctccgacgacggtccgcagggtaacgccgaaaaatac
gcgcacgagctgatcggtgacttaaataactttgcgaacggttttatcgattggaatttg
ctgctagatgaagaaggcggcccgaatcatgcacgaaatttctgcgacgcagcggtacgg
acccgtatccgcgccggtaaaacggaactcgaattccgtccggcgtattattatatgggg
catttcagcaaattcatctttccttgcagccgccgtattgcggtctcccgattttcggat
aaacttgagacctgcgcgttcaaacgaccggacggaaaacttgtgttaatcgttctgaac
cggtcggatactgcggcagaatccgtcatttccgtaccggaatacggaatcgcctccgcc
tcttttaaaccgcacagcatcaagaccgtcgtgctgccgtaa

DBGET integrated database retrieval system