KEGG   Treponema brennaborense: Trebr_0373Help
Entry
Trebr_0373        CDS       T01489                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tbe  Treponema brennaborense
Pathway
tbe00521  Streptomycin biosynthesis
tbe00523  Polyketide sugar unit biosynthesis
tbe01130  Biosynthesis of antibiotics
Module
tbe_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Trebr_0373
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Trebr_0373
Enzymes [BR:tbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Trebr_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEE15820
UniProt: F4LN34
Position
complement(439841..440422)
Genome map
AA seq 193 aa AA seqDB search
MAFTFTPCSISGLYEIQPKLFGDSRGYFLETYSEKDFFAAGLTMRFVQDNQSSSSKGVLR
GLHFQKRFPQGKLVRALSGEVYDVAVDLRVGSPTFGQYHGVVLSAEKQNQFYIPAGFAHG
FFVLSDTAVFAYKCTDFYHPEDEGGIPWNDPAFGIDWRALAPGTEPILSAKDTAHPAFDP
AAAYFDENGVWIS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacgtttactccatgctccatcagcggactgtacgaaatacagccgaaatta
ttcggcgacagccgcgggtactttcttgaaacgtacagtgaaaaggatttttttgccgcg
ggactcacgatgcggttcgtgcaggacaaccagtcgtcgtcctcaaaaggcgtgctccgc
gggcttcattttcagaaacggtttccgcaaggcaaattggtgcgcgcgctttcgggtgaa
gtatacgacgtagccgtcgacctgcgcgtcggttcgcccacgttcggacagtatcacggc
gtagttctttcggcggaaaaacagaatcagttttacataccggcgggttttgctcacggt
tttttcgtactcagcgatacggcggtgttcgcgtataaatgtaccgatttttatcatcca
gaggatgagggcgggattccgtggaacgatccggcgttcggcatcgattggagagcgctc
gctcccggaacggaaccgattttgtcggcaaaagacacggcgcatccggcgttcgatccg
gccgcggcgtattttgacgaaaacggcgtctggatatcgtaa

DBGET integrated database retrieval system