KEGG   Treponema brennaborense: Trebr_0397Help
Entry
Trebr_0397        CDS       T01489                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tbe  Treponema brennaborense
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Trebr_0397
Enzymes [BR:tbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Trebr_0397
Exosome [BR:tbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Trebr_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480825..482321
Genome map
AA seq 498 aa AA seqDB search
MKRYVVALDQGTTSSRCIIFDREQRVVCQGQREFTQYYPKPGWVEQAPMEIYSCQYGVLM
EVLAQSGIPVSQIAGIGITNQRETTIVWDRETGHPVYNAIVWQCRRTAKLCEELKKDAAF
AAAVTDKTGLLVDAYFSATKIKWILDNVPGAREKARGGELLFGTVDTWLVWKLTEGRLHV
TDYTNASRTMLYDINRLCWDEDICARLDIPTAMLPEVHNSSEIYGTMNIQGKEVPLAGIA
GDQQAALFGQTCFEPGDVKNTYGTGCFLLMNTGDTVCRSKNGLLSTIAVGLNGSVQYALE
GSVFVGGAVIQWVRDELRLITEACDAEYYARKVPDSGGVYLVPAFTGLGAPYWDMYARGC
LIGLTRGTKREHIIRAAQESIAYQTFDLVRAMEKDTALRLGTLNVDGGATRDKFLMQFQA
DILGTPVQRPLVRETTALGAAFLAGLATGFWHDTDEIRQLRLLDNRYLPQLPPERRASLL
DGWHKAVGRSLGWAEPEA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatacgtcgtcgcgctggatcagggaacgaccagcagccgctgcatcatattc
gaccgcgaacagcgcgtcgtctgtcaggggcagcgcgaatttacccagtattatcccaaa
cccggctgggtcgaacaggctcccatggagatttattcgtgccaatacggcgtgctgatg
gaagttcttgcgcagagcggcattcccgtttcccaaatcgccggaatcggcattacgaat
cagcgtgaaacgacgatcgtctgggatcgggaaaccgggcatccggtctataacgcgatc
gtctggcagtgccgccggacggcgaaattgtgcgaagaactgaaaaaggacgccgcgttc
gccgccgccgtaaccgacaaaacgggactgctcgtggacgcgtatttttcggcaaccaaa
ataaaatggattttggacaacgtgccgggcgcgcgtgaaaaagcgcgcggcggcgaactg
ctgttcggtaccgtcgacacctggctcgtctggaaactgaccgaagggcggctgcacgtt
accgattatacgaacgcgagccgcacgatgctgtacgatatcaaccgtttgtgctgggac
gaggatatctgcgcccggctcgatattccgacggcgatgctgccggaagttcacaattcg
agcgaaatatacggtacgatgaacattcaaggcaaagaagttccgctggcgggcatcgcc
ggagaccagcaggcagcgctgttcggccaaacgtgtttcgagccgggcgacgtaaaaaat
acgtacggaaccggctgctttttgctcatgaacaccggcgacacggtgtgccgcagcaaa
aacgggctgctttccacgattgccgtgggactgaacggttcggtgcaatacgcgcttgaa
ggcagcgtattcgtcggcggcgcggttatccagtgggtgcgcgacgaactgcggctcata
acggaagcctgtgacgccgaatattacgcgcgaaaagtgccggattccggcggcgtgtat
ttggtgcccgcctttacggggctgggcgcaccgtattgggacatgtacgcgcgcggttgc
ctgatcgggctgacgcgcggcaccaaacgcgaacatatcatccgcgccgcgcaggaatcg
attgcgtatcagactttcgatttggtgcgtgcgatggaaaaagataccgcgcttcggttg
ggaacgctcaacgtcgacggcggtgcgacgcgcgataaattcctgatgcagtttcaggcg
gacattttgggaacaccggtgcagcggccgctcgtccgtgaaaccaccgcgctgggagcg
gcgttccttgcgggattggcaacgggattctggcacgatacggatgaaatacggcagctg
cgtcttttggacaatcggtatctgccgcaactgccgccggaacggcgcgcgtcgctgctg
gacggctggcataaagcggtcgggcgcagcctcggctgggcggaaccggaagcgtaa

DBGET integrated database retrieval system