KEGG   Treponema brennaborense: Trebr_0491Help
Entry
Trebr_0491        CDS       T01489                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tbe  Treponema brennaborense
Pathway
tbe00240  Pyrimidine metabolism
tbe00250  Alanine, aspartate and glutamate metabolism
tbe01100  Metabolic pathways
Module
tbe_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Trebr_0491
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Trebr_0491
Enzymes [BR:tbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Trebr_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEE15935
UniProt: F4LP59
Position
complement(607973..608896)
Genome map
AA seq 307 aa AA seqDB search
MLKGRHLIEPADLTVQEIDEICSLAEQIIVDPSAFTDVCRGKILAALFFEPSTRTRLSFE
AAMLRLGGSTLGFADAASTSSTKGETLADTIRVVSSYADVIAMRNPKEGSALVASQYSAV
PVINAGDGGHHHPTQTLTDLLTIRSLKGDLDGHTIGFCGDLRFGRTVHSLAKAMSRYKNN
TFVLISPPELTIPEYIVSQVIKPSGIAYSESLRLEDVIGDLDILYMTRVQAERFFNEQDY
IRLKDSYILNREKMKLAKDSMIVLHPLPRVNEISPEVDADPRAAYFKQVKYGMFARMALI
AKLTGAL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaggacgtcacctgatagaaccagcagatctgacagtgcaggaaattgatgaa
atttgttcccttgcagaacaaattatcgtcgatccttctgcttttaccgatgtgtgccgc
gggaaaattcttgcggcacttttttttgagccgagcaccagaacgcggctttcctttgaa
gcggccatgctcagactcggcggttcgacgctcggattcgcggacgcggcgtcgacatca
tcgaccaaaggcgaaaccctcgcagacacgattcgggtcgtctcctcctacgcggacgtc
atcgcgatgcgcaaccccaaagaaggttcggcgctggtcgcctcgcagtattccgccgta
cccgtcatcaacgccggcgacggcggacaccaccatccgacgcaaacgctcaccgacttg
ctcacgatccgctcgctgaaaggcgatttggacggacacacaatcgggttctgcggcgat
ctccgcttcgggcgaaccgtgcacagtctggcaaaagcgatgagccgctacaagaacaat
acgttcgtccttatcagcccgccggaactgacgattcccgaatacatcgtttcccaagtt
atcaaaccgtccggcatcgcgtattcggaatcgctgcgtctggaagacgtcatcggcgac
ctcgacatcctgtacatgacccgcgtacaggcggaacgctttttcaacgaacaggattac
atccgcctcaaagacagttacatcctcaatcgcgaaaaaatgaaactcgccaaagattca
atgatcgtcctgcacccgctgccgcgcgtcaacgaaatatcgcccgaagtggacgccgac
ccgcgcgccgcgtacttcaagcaggtaaaatacggtatgttcgcccgcatggcgctgatc
gccaaattaacaggagctttataa

DBGET integrated database retrieval system