KEGG   Treponema brennaborense: Trebr_0693Help
Entry
Trebr_0693        CDS       T01489                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tbe  Treponema brennaborense
Pathway
tbe00250  Alanine, aspartate and glutamate metabolism
tbe01100  Metabolic pathways
tbe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Trebr_0693
Enzymes [BR:tbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Trebr_0693
Peptidases [BR:tbe01002]
 Cysteine Peptidases
  Family C44
   Trebr_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AEE16135
UniProt: F4LQB4
Position
855317..857047
Genome map
AA seq 576 aa AA seqDB search
MCGFVGMFDLNSGSVPLEDGLREELRSRLLDMSKKIRHRGPDWSGVYTGANALLSHERLS
IVDPLSGKQPLISEDGNVILAVNGEIYNHQEIRKRYEGRYTFKTQSDCEVILPLYQEKGA
AFLEDLSGIFAFALYDKQNDVYLVARDHIGIIPLYQGWDEDGRYYVASELKALEGTCCTI
EEFPNGCYFYSKDSAPVKWYERDWTDYAAVQNNVSSIAELRAGLETAVKKQLMSDVPYGV
LLSGGLDSSIIAAVTKKFSARRVESGGTQEAWWPQLHSFAVGLEGAPDLLAARKAAEFIG
TVHHEVHFTIQEALDALSDVIYHLETYDITTVRASTPMYLLARVIKSMGIKMVLSGEGAD
ELFGGYLYFHKAPDAKEFHEETVRKLGKLHLYDCLRANKALAAWGVEGRVPFLDKEFIDV
AMRLNPEDKMSSRCEPGTKGAGRDGRRMEKWILRKAFEEYLPESIAWRQKEQFSDGVGYS
WIDTLKKIAEERVSDQQFAAAAKRFPINTPLNKEEYYYRSLFAKFFPSETAAKTVPHEAS
VACSTAKALEWDASFKNMNDPSGRAVSGVHDEAYSK
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgtcggtatgtttgacttgaactccggttcggtcccgctggaagacgga
ctgcgtgaagaattgcgcagccggcttcttgatatgtcaaaaaaaatccgccaccgcggt
ccggattggtccggcgtatataccggagcaaacgccctgctcagtcacgaacgtctttcg
atcgttgatccgctttccggcaaacagccgctgataagtgaagacggcaacgtaatcctt
gccgtcaacggtgaaatttacaatcatcaggaaatcagaaaacggtacgaaggccgctat
acgtttaaaacgcagtcggactgtgaagtcattcttccgctgtatcaggaaaagggagcg
gcctttcttgaagatctgagcggcatattcgcgttcgccttatacgacaagcaaaatgat
gtgtatctggtagcccgcgatcacatcggcatcattccgctgtatcagggatgggacgaa
gacggccggtattacgttgcgagcgaactgaaagcgcttgaaggtacgtgctgtacgata
gaagaattcccgaacgggtgttatttttacagcaaagactctgcgccggtaaaatggtac
gaacgcgactggacggattacgccgccgtacagaacaacgtttcaagcatagccgagctg
cgcgcgggacttgagacggcggtcaaaaaacagctgatgagcgacgtgccgtacggcgta
ctgctatcgggcggcctggattcttccattattgcggccgttaccaaaaagttttcggca
cgccgggtcgaaagcggcggtacgcaggaagcgtggtggccgcagctgcacagtttcgcc
gtcggtttggaaggtgcgcccgacttgctcgccgcgcggaaagcggccgaatttatcggc
acggtgcatcacgaagtgcattttacgattcaggaagcgctggacgcgctgagcgacgtt
atctatcaccttgaaacgtacgacatcacgacggtgcgcgcgtctacgccgatgtatttg
cttgcccgcgtgataaaatcgatggggatcaaaatggtgctttcaggcgaaggcgccgac
gaactgttcggcggctacttgtattttcacaaggcgcccgacgcgaaagagtttcacgaa
gaaacggtgcgcaaactcggaaaactgcacttgtacgattgtttacgcgcgaacaaggcg
ctcgcggcgtggggcgtggaagggcgcgtgccgtttttggataaggaatttatcgacgtc
gcgatgcggctgaatcccgaagacaaaatgagttcccgctgcgagccggggacgaaaggt
gccggccgcgacggccgccgtatggaaaaatggattttgcgcaaagcgtttgaagagtat
ttgcccgaatcgattgcgtggcggcagaaagagcagttttccgacggcgtcggctacagc
tggatcgatacgctgaaaaaaatcgcagaagaacgcgtttcggatcagcagtttgccgcc
gccgcgaagcgttttccgataaacacgccgctcaataaggaagaatactattaccgttcc
ctttttgccaagttttttccgtcggaaacggcggctaaaacggttccgcacgaagcttcc
gttgcctgttcaacggcgaaagcgctcgaatgggacgcatcgttcaaaaatatgaatgat
ccgtccggccgcgccgtttcgggcgtacatgatgaagcgtattcaaaataa

DBGET integrated database retrieval system