KEGG   Treponema brennaborense: Trebr_1345Help
Entry
Trebr_1345        CDS       T01489                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tbe  Treponema brennaborense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trebr_1345
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trebr_1345
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Trebr_1345
Enzymes [BR:tbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Trebr_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1592166..1593578)
Genome map
AA seq 470 aa AA seqDB search
MIYTDTRDSCVRSDFRTAVMNGMNAETGGLYIPVEFPKLDKSFLGKNPEPSFRDIAFESA
KPFVGNEIPSDDLQAIIADAYPFSAQVVPVDPVSYVLELFHGPTCAFKDFGARFMARVMS
YFNRSESDPLHILVATSGDTGSAVGSAFYNVPGLDVTILYPEGKISPLQEKQLSTFTGNV
RSLRVAGTFDDCQKLVKTAFTDSQLRGRFRLSSANSINIARLLPQSFYYTYAALVVKHRS
PRDNKIDDPAIIFTVPSGNFGNLTSGLIAREMGAPITGFVAATNANRTVPDWIASGEYRP
RPSVATLSNAMDVGAPSNYERIKAIYPLEKVRELFASYWLDDEGTMDAIRSCYSRTGYII
DPHGAVAWHAWDDIRRGAMTRLMGGLAGSPNEPGLTPNVPAWAQRVAGKSAVGVILETAH
PAKFGETVKEAIGREPSLPDRLEKVMSLPDMSIPMAADYEAFRAWLVANL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagataccagagattcttgcgtccgttccgatttcaggactgccgtcatg
aacggtatgaatgccgaaacaggcggtttatatattcccgttgagtttcccaaactcgat
aagagttttttgggtaaaaatccggaaccttcgttccgtgatattgcgttcgagtcggca
aagccgttcgtcggtaacgaaattccgtccgacgatttgcaggctatcatagcggatgcg
tatccgttcagtgcgcaggtggttcccgttgatccggtttcgtacgttttggaactgttt
cacggaccgacgtgtgcatttaaagacttcggcgcgcgttttatggcgcgcgtcatgtcg
tactttaaccggagcgagtcggatccgctgcatatcctcgtggcgacgtccggcgacacc
ggcagcgcggtcggcagtgcgttttataacgtgcccggtctcgacgttaccattttgtat
cccgaaggaaaaatcagcccgctgcaggaaaagcagctttcaacgttcaccggaaacgtg
cgctcgctgcgcgttgccggtacgttcgacgactgccagaaactggtgaaaaccgcgttt
accgattcgcaactgcgcggccgcttccggctgtcttcggcaaactcgattaatatagcc
cgattgctgccgcaaagcttctattatacgtacgcagcgctcgtggttaagcaccgcagc
ccgcgcgacaataaaatcgacgatccggcgatcattttcaccgttccgtcgggaaacttc
ggtaatctgacgtccgggctgatcgcgcgtgaaatgggagcgcccattaccggcttcgtt
gccgcgacgaacgcgaaccgcaccgttcccgattggattgcaagcggcgaataccgcccc
cgcccgtcggtggcgacactgtcgaacgcgatggacgtcggcgcaccgagtaattacgaa
cgaatcaaagcgatatatccgcttgaaaaagtgcgcgaactgttcgcttcttactggctt
gacgacgaaggcactatggacgcaatccgcagctgttattcgcgtaccggctatattatc
gatccgcacggcgcggtcgcgtggcacgcgtgggacgatatccgccgcggcgccatgacc
aggcttatgggcggactcgccggttcgcccaacgaaccgggactgacgccgaacgttccc
gcttgggcacaacgcgtcgccggaaaatctgcggtcggcgtgattcttgaaaccgcgcat
ccggcaaaattcggcgaaacggtcaaagaagcaatcggccgtgaaccgtcgctgcccgac
cggctcgaaaaagtgatgtcgctgcccgatatgtcaattccgatggccgcagattacgaa
gcgttccgcgcctggctcgttgccaatttatag

DBGET integrated database retrieval system