KEGG   Treponema brennaborense: Trebr_1425Help
Entry
Trebr_1425        CDS       T01489                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tbe  Treponema brennaborense
Pathway
tbe00900  Terpenoid backbone biosynthesis
tbe01100  Metabolic pathways
tbe01110  Biosynthesis of secondary metabolites
tbe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Trebr_1425
Enzymes [BR:tbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Trebr_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEE16849
UniProt: F4LN84
Position
1679871..1681007
Genome map
AA seq 378 aa AA seqDB search
MKKRVLVLGCTGSIGTSTLDIIREFPDRFEAAGLTAHTAAGKLKALAAEFKCPALLTGPA
TEAETEHFIRSSGADVAVNGIAGSAGLKPSVMVLNAGIDLALANKETIVMAGPLVIRLAE
ENGCALLPVDSEHSAIFNLIRHYGADSVSEIILTASGGPFRCVPADELPSVTAAQALRHP
TWDMGQKITIDSATLANKGLEVIEACRLFGFPPERVKVTVHPQSLVHSLVKTNDGVLYAQ
ISHPDMRHPILSALTWPETVPNSLEPFDITCLNAGADGKEITMTFAAPRLNDFPMLPLAY
EAAAKGGSYTIAYNAANEVAALAFLQGKAAFRDIDRITARVMQKDWSTPPVTIADVFLFD
SQARSYAEQLLTASGGSD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagggttctcgtcctcggctgcaccggttccatcggcaccagcacactcgat
atcatccgcgaatttccggatcgttttgaagcggcgggacttaccgcgcatacggcggcc
gggaaactgaaagcgcttgcggcagagttcaaatgcccggcactcctcaccggtccggcg
acggaagccgaaacggagcactttatccgttcaagcggagcggacgtcgcggtaaacgga
atcgccggctcggcgggattgaagccgtcggtcatggttttgaacgccggcatcgatttg
gcgcttgcaaacaaggaaacgatcgttatggccggcccgctcgttatccgattggccgaa
gaaaacggctgcgcgctgctgccggtcgattcggaacattcggcgatattcaatttgata
cggcattacggtgccgattcagtatcggaaatcatactgacggcgtccggcggacctttc
agatgcgtccctgcggacgaacttccgtcggtaaccgccgcacaagcgctccgccatccg
acgtgggatatgggacaaaagattacgatcgattccgcgacgcttgccaataagggactt
gaagtcatagaggcgtgccggcttttcggttttccgcccgaacgggtaaaagtgaccgtt
cacccgcaaagtctcgtgcattcgctcgtcaaaacgaacgacggcgtgctgtacgcgcag
atttcgcatccggacatgcggcatcccattttaagcgcgctgacctggccggaaaccgtc
ccgaattcgcttgaaccgttcgatatcacctgcctgaacgccggcgccgacggcaaagaa
ataaccatgacgttcgccgctccccggctgaacgattttccgatgctgccgctcgcgtat
gaagcggcagcgaaaggcggttcgtatacgatcgcgtacaacgccgcgaacgaagtcgcc
gccctcgcctttctgcagggaaaagccgcgttccgcgatatagaccgcataaccgcacgg
gttatgcaaaaagactggagtacgccgcctgttaccattgccgacgtatttttgtttgat
tcacaggcgcgttcgtatgcggaacaattgctgacggcgtccggaggttctgattga

DBGET integrated database retrieval system