KEGG   Treponema brennaborense: Trebr_1625Help
Entry
Trebr_1625        CDS       T01489                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tbe  Treponema brennaborense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trebr_1625
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trebr_1625
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Trebr_1625
Enzymes [BR:tbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Trebr_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1921175..1922581
Genome map
AA seq 468 aa AA seqDB search
MNDYRNDGYFGRFGGKYVAEVLRRPLDELETAFYEAMNDEAFRAELDELRRDYIGRETPL
LFAENATRELGGGRIYIKMEGLAHTGAHKINNALAQALLAKRMGKTRIIAETGAGQHGLA
TAAACAKLGLACTVYMGEVDVRRQQPNVAAMELYGAEVRPVASGSRTLKDAINEAMRDWA
AHFETTHYLIGSALGPAPFPDIVRTFQSVIGEEVKKQAAERHIDIAALCACVGGGSNAIG
FFAPFIGGESAARLNPASARTVSTAESLSGENPLHPNALPRLLAAEAGGIGSGIGENAVR
MSGNAARDGIVHGYKSRFLLTPDGQVAQTRSISAGLDYPGIGPQLAALGTSGRIEFSAVR
DDEALAALAFFAKHEGVLFALESAHAGALAMRIAQEIPRDKAIIINMSGRGDKDIFITSP
VFRPAEWRRFLKSELARLESGTDIHQAESPADSCERAAADTADRPVRQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattaccgtaacgacggatatttcggcagattcggcggaaaatacgttgccgaa
gtactgcgccggccgctcgatgaacttgaaacggcgttttatgaagcgatgaacgacgaa
gcgttccgtgccgaactcgacgaattgcgccgcgactatatcggacgggaaacaccgctt
ctgttcgcggaaaacgccacgcgcgaactcggcggcggccgcatttacataaaaatggaa
ggacttgcacacaccggcgcgcacaaaatcaacaacgcgctcgcgcaggcactccttgcc
aaacggatgggaaaaacgcgcatcatagcggaaaccggcgccggacagcacgggctcgcc
acggccgccgcctgtgcgaaactcgggctcgcgtgcaccgtgtatatgggagaagtcgac
gtcagacggcagcaaccgaacgtcgccgccatggaattgtacggcgcagaagtgcgcccg
gttgcttcgggttcgcgcacgctgaaagacgctatcaacgaggcgatgcgcgactgggcg
gcgcatttcgagacgactcattacctgatcggttccgcgctcggcccggcgccgtttccc
gatatcgtgcgcacgttccaatcggtcatcggtgaagaagtcaaaaaacaggcggccgaa
cggcatatcgacattgcagcgttgtgcgcatgcgtcggcggcggctcgaacgcgatcggc
ttttttgcaccctttatcggcggagaatcggccgcacggctgaatcccgcatccgcacga
acggtttccactgccgaatcgttatccggtgaaaacccgctgcacccgaacgcactgccc
cggctgctcgccgcggaagcgggcggcatcggttccggtatcggcgaaaacgccgtacgc
atgagcggaaacgccgcgcgcgacggaatcgtgcacggctacaaaagccggtttctgctg
acgccggacgggcaagttgcccaaacgcgctcaatctcggcagggctcgactatccggga
atcggtccgcagctcgccgcgctcggaacttccggcagaatcgaattttcggcagtccgg
gacgatgaagcgctcgccgcgcttgcgttttttgcaaaacacgaaggcgttctgttcgcg
cttgaaagcgcgcacgcaggagcgctcgcgatgcggattgcacaagaaattccgcgcgat
aaagcgatcatcataaacatgtccggacgcggcgacaaggacattttcatcacgtcgccg
gtgttccgccccgccgaatggcgacgttttttgaagagcgaactcgcgcggctcgaaagc
ggaacggatattcatcaggccgaatcgccggccgattcgtgcgaacgggcggcagcggat
actgcggaccgcccggtgcggcagtaa

DBGET integrated database retrieval system