KEGG   Treponema brennaborense: Trebr_1626Help
Entry
Trebr_1626        CDS       T01489                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tbe  Treponema brennaborense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trebr_1626
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trebr_1626
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Trebr_1626
Enzymes [BR:tbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Trebr_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1922606..1923427
Genome map
AA seq 273 aa AA seqDB search
METIRNIKIPARAPITLMAHLVAGYPTDDAAFEAARALVRGGASILEIQLPFSDPSADGP
AIQSTCASVLRRGYKTADGFKLIDRIRTAFPDVPVFVMTYASLAYAPGIETFVRRAAEAG
VAGIIVPDLPFDADEGLAEACRRNGLHMIPVAAPSMSPHRLSQLARAGFPYLYAALRAGI
TGEKTVIGSGTVDFIRNVSAGGSAVFGGFGIETGEQAAALAPTVAAVVAGSVFVRTIAAC
TASGGTDAMAALNAAVSAKARELSGQAPEHKRQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgatacgaaatataaaaataccggcgcgcgcaccgatcacgttgatggcacac
ctcgtcgcaggatatccgacggacgacgcggcgtttgaagcggcgcgggcactcgtacgg
ggcggcgcttcgattctcgaaatacagctgccgttcagcgacccgtctgcagacgggccg
gcaatccagagcacctgcgcttcggtgctgcggcgcggctacaaaacggcggacggattc
aaactgatcgatcggatacggacggcgtttcccgacgttccggttttcgtaatgacgtac
gcgtccctcgcctacgcgcccggaatcgaaacgttcgtccgacgcgcggcggaagcggga
gtcgcggggataatcgtccccgatctgccgttcgacgccgacgagggactcgccgaagcc
tgccggagaaacggcctgcatatgattcccgtcgccgctccgtcgatgagtccgcaccgg
ctttcacagcttgcacgtgcgggtttcccgtacctgtacgccgcactccgcgccggcatc
accggagaaaaaacggttatcggcagcggcaccgtcgatttcatcaggaacgtgtcggcg
ggaggatccgccgtattcggcggcttcggtattgaaaccggcgaacaggcggcggcgctc
gcaccgacggtagccgcggtcgtcgccggttccgtgttcgtgcgaacgatagccgcctgc
accgcttccggcggtacggacgctatggccgcgctgaatgcggcggtttcggccaaagcc
cgcgaactatcgggtcaggcgccggaacacaagcggcagtaa

DBGET integrated database retrieval system