KEGG   Treponema brennaborense: Trebr_1707Help
Entry
Trebr_1707        CDS       T01489                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tbe  Treponema brennaborense
Pathway
tbe00010  Glycolysis / Gluconeogenesis
tbe00051  Fructose and mannose metabolism
tbe01100  Metabolic pathways
tbe01110  Biosynthesis of secondary metabolites
tbe01120  Microbial metabolism in diverse environments
tbe01130  Biosynthesis of antibiotics
tbe01200  Carbon metabolism
tbe01230  Biosynthesis of amino acids
Module
tbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tbe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trebr_1707
   00051 Fructose and mannose metabolism
    Trebr_1707
   00562 Inositol phosphate metabolism
    Trebr_1707
Enzymes [BR:tbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Trebr_1707
Exosome [BR:tbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Trebr_1707
  Exosomal proteins of bladder cancer cells
   Trebr_1707
  Exosomal proteins of melanoma cells
   Trebr_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF4254 DUF473
Motif
Other DBs
NCBI-ProteinID: AEE17129
UniProt: F4LQ51
Position
complement(2008715..2009464)
Genome map
AA seq 249 aa AA seqDB search
MRQYYIAGNWKMNKIKGEAVELATGLVSALKDGKNKYMIAPSFTNLDAVAQVVKGSNILL
GAQNMSTELSGAHTGEVSALMLKDLGVQVVILGHSERRHIYKEDDAMINKKVKLALEQGL
DVVLCIGELLEEREAGKAEAVCEAQTRKGLAGVSAEQMKKITVAYEPVWAIGTGKTATPD
DAQAIHKFTRGVLADMFGKSVAEATIIQYGGSMNASNAAALLAQPDVDGGLIGGAALKVE
TFEPICKTY
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagacaatattatattgctggtaactggaaaatgaacaaaatcaagggcgaagcggta
gagcttgcaactggtcttgtttcagctttaaaagacggaaaaaataaatacatgatcgct
ccgtcgttcactaatctcgatgcggttgcgcaggttgtgaagggttcaaatattctgctc
ggtgctcagaatatgtcgacggaattgtccggtgcgcataccggtgaagtttccgctctt
atgctcaaagatttgggcgttcaggtcgttattctcggccattcggaacgccgccatatt
tataaagaagatgacgcgatgatcaataagaaagttaaactggcgcttgaacagggcctc
gacgtcgtgctgtgtatcggcgaactgttggaagaacgtgaagccggtaaagcggaagcc
gtttgtgaagcacagacccgcaaagggctcgcgggcgtcagcgcggaacagatgaaaaaa
atcacggtcgcgtacgaacccgtttgggctatcggtaccggtaaaaccgctactcccgac
gacgcgcaggctatccataagtttacgcgcggcgtgcttgccgacatgttcggtaaatcg
gttgccgaagcgaccatcattcagtacggcggttcgatgaacgcttccaacgcagccgcg
ctgctcgcgcagcccgacgtcgacggcggactgatcggcggtgccgcgctgaaagtcgaa
acgtttgaacccatctgcaaaacgtactag

DBGET integrated database retrieval system