KEGG   Treponema brennaborense: Trebr_1772Help
Entry
Trebr_1772        CDS       T01489                                 

Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tbe  Treponema brennaborense
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Trebr_1772
Enzymes [BR:tbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Trebr_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2094170..2095156)
Genome map
AA seq 328 aa AA seqDB search
MSTRYYKKKSFSKNIRKVFDNFLIYCIIAELMLHDIHVSAPAKINIGLRVLPVRSDGYHD
IESIFQTVPLYDELFIRTGNTAVRTCTVVCDGMDLPEHNTLTAAYDAFCSATGITDGVAV
TLKKRIPSGAGLGGGSADAAAFIKALNVSFETKLTADVLHGIAGKVGSDVFFFLSGSSLV
DAPDCSGCAVVTGRGEKVFPITPRTDLHFVLICPDVHSSTGEAYRLVDAYYASGHQDWNG
PSREELYDVYKRPVKSWSFVNSFTEPLVQRYPLIGQALDDLVLNGASYVQMSGSGSAVFG
VFEDSDKAVHACFVLGVKWKRCYTFASS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactagatattataaaaaaaaatcattttcaaaaaatatccgtaaagtatttgac
aatttccttatttattgtataatagcagagcttatgttgcacgatattcatgtgtccgct
cctgcgaaaatcaatatcggactcagggttttaccggtccggtcggacggttatcatgat
atcgaaagcatttttcaaaccgtgccgttatacgatgaattgtttatcaggacgggaaat
acggcggtacgaacctgtacggtcgtgtgcgacggaatggatttgccggaacataatacg
ttgacggccgcgtacgacgctttttgcagcgcgaccggtataacggacggtgttgccgtt
acgctgaaaaaacgtattccgagcggcgcaggtcttggcggcggttccgccgacgcggcg
gcctttataaaggcgcttaacgtgtcgtttgaaacgaagttgactgccgatgtgctgcat
ggtattgccggaaaagtcggcagtgacgtattttttttcttgagcggcagctctttggtt
gacgcgccggattgttccggatgtgcggtggtaacggggcggggagaaaaggtttttccg
ataacgccccgaacggatttacattttgttttgatttgtcctgatgtgcatagttctacg
ggagaagcgtaccgcttagtcgatgcgtattacgcttcggggcatcaggattggaacgga
ccttcacgggaagagctgtatgatgtatataagcggccggttaaaagctggtcgtttgta
aatagctttacggaacctctcgtgcagcggtatccgcttattgggcaagctttagatgac
cttgtgctgaacggtgcatcgtatgtccaaatgtccggctcgggatctgcggtttttgga
gtttttgaagattctgataaagcagttcacgcctgttttgtacttggtgtaaaatggaag
cggtgttatacattcgcttcttcctga

DBGET integrated database retrieval system