KEGG   Treponema brennaborense: Trebr_1880Help
Entry
Trebr_1880        CDS       T01489                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tbe  Treponema brennaborense
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tbe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tbe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2213169..2214842
Genome map
AA seq 557 aa AA seqDB search
MQKRLSQLLTGFQHETAGGSSDPIITDICFDSRAVRAGSLFFALPGTHVHGNAFIAKAIA
RGAAAIVYQDDLPEDALRAAEERNNEAEAPVLVRVRDARFAMSPAADAFYDSPSEKLAVI
GVTGTEGKSSTVSFIWQLLGLCGKKAGFISTVQYSLGDDAIANPEHQTTPEAPIVQRQLY
EMVQNGCEYAVVESSSHGLSRKTNRLGDVRFDAGVFMNVTHEHLEFHGTHEQYKSDKANL
FRALDAHDHLKTIGGTRRRVPAFGVVNLEDPAAAYFNDATEKTVYGFTTGGAAGKNADIP
LPEIPAEIPRFSADRVAAKSDGIAFTANVPPSDTIRATAPDPVAVTAPLPGAFNVYNVLA
SLITVSTITGIPFARVAEKCPQLQPVKGRMTVIDKGQPFEVIVDYAHTPSSFETIFPPLR
KRARNRIIVLFGSGGERDTKKRPEQGRIAARWCDVVILADEDPRAEDPAALLEMIAAGCR
SAGKTEGNGLYVVPPRPQAIRKAFALAAEGDIVLLLGKAHENSIIYKDYTMPYDEIAEAE
KALAEAGFTGRTGGGSV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacggctttcacaattgctcaccgggtttcagcacgaaacggctggcggatcc
tcggatccgataattacggatatatgtttcgattcacgggcggtacgcgcgggatctttg
tttttcgcgctgccgggaacgcacgttcacggcaacgcttttatagcgaaagcaatcgca
cgaggcgcggcggcaatcgtctatcaggatgatttgcccgaagacgcactgcgcgccgcc
gaagaaaggaacaacgaagcggaagcaccggtactcgtccgggtacgggacgcgcggttc
gccatgtcgcccgctgcggacgctttttacgattcaccgtcggaaaaactcgccgttatc
ggcgtaaccggtacggaaggcaaaagttcaaccgtatcgtttatctggcagctgctcgga
ctctgcggcaaaaaagcgggattcatttccaccgtgcagtactcgctcggagacgacgcg
atagccaatcccgaacatcagacgacgccggaagcacccatcgtgcagcggcagctctac
gaaatggtgcaaaacggatgcgagtacgccgtcgtggagtcttcttcccacggcctgtcc
cgtaaaacgaaccggctcggagacgtccgcttcgacgcgggcgtattcatgaacgttacg
cacgaacatctggaatttcacggtacgcacgaacaatataaaagcgacaaggcgaatctg
ttccgcgcgctcgacgcgcacgatcatctgaaaacgatcggcggcacacggcgcagggtt
cccgcgttcggcgtcgtcaatcttgaagaccccgccgccgcttatttcaacgacgccacg
gagaaaaccgtctacgggtttaccaccggcggagcggcaggcaaaaacgcggatattccg
ctgcctgaaattcctgccgaaattccccgcttttccgcagaccgcgttgcggcaaaatcg
gacggaatcgcttttaccgcaaacgttccgccctcggacacgattcgggccaccgcaccc
gacccggtcgccgtaacagcgccgctccccggcgcgttcaacgtatataacgtactcgcc
tcgctcatcacggtgagcacgataaccggcattccgtttgcacgcgttgccgaaaaatgc
ccgcagctgcagccggtaaaaggccgcatgaccgtcatcgacaaaggacagccctttgaa
gtgatcgtggattacgcgcacacgccgtcttcgttcgagaccatttttccgccgctccgt
aaacgcgcccggaaccgcattatcgtactgttcggctcaggcggcgaacgcgacaccaaa
aaacgcccggaacaaggccgcatcgccgcacgctggtgcgacgtcgtcattcttgccgac
gaagacccgcgcgcagaagatccggcggcgctgctcgagatgattgcggcgggctgccgc
agtgcgggcaaaaccgaaggaaacggactgtacgtcgttccgccgcgcccgcaagccatc
cgcaaagcgtttgccctcgccgctgaaggcgacatcgttttgctgctcggaaaagctcac
gaaaattcaattatatataaagattacaccatgccctacgatgaaatcgccgaagcggaa
aaagcgcttgccgaagcgggcttcaccggcaggacgggcggaggttcagtgtga

DBGET integrated database retrieval system