KEGG   Treponema brennaborense: Trebr_1880Help
Entry
Trebr_1880        CDS       T01489                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tbe  Treponema brennaborense
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Trebr_1880
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Trebr_1880
Enzymes [BR:tbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Trebr_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2213169..2214842
Genome map
AA seq 557 aa AA seqDB search
MQKRLSQLLTGFQHETAGGSSDPIITDICFDSRAVRAGSLFFALPGTHVHGNAFIAKAIA
RGAAAIVYQDDLPEDALRAAEERNNEAEAPVLVRVRDARFAMSPAADAFYDSPSEKLAVI
GVTGTEGKSSTVSFIWQLLGLCGKKAGFISTVQYSLGDDAIANPEHQTTPEAPIVQRQLY
EMVQNGCEYAVVESSSHGLSRKTNRLGDVRFDAGVFMNVTHEHLEFHGTHEQYKSDKANL
FRALDAHDHLKTIGGTRRRVPAFGVVNLEDPAAAYFNDATEKTVYGFTTGGAAGKNADIP
LPEIPAEIPRFSADRVAAKSDGIAFTANVPPSDTIRATAPDPVAVTAPLPGAFNVYNVLA
SLITVSTITGIPFARVAEKCPQLQPVKGRMTVIDKGQPFEVIVDYAHTPSSFETIFPPLR
KRARNRIIVLFGSGGERDTKKRPEQGRIAARWCDVVILADEDPRAEDPAALLEMIAAGCR
SAGKTEGNGLYVVPPRPQAIRKAFALAAEGDIVLLLGKAHENSIIYKDYTMPYDEIAEAE
KALAEAGFTGRTGGGSV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacggctttcacaattgctcaccgggtttcagcacgaaacggctggcggatcc
tcggatccgataattacggatatatgtttcgattcacgggcggtacgcgcgggatctttg
tttttcgcgctgccgggaacgcacgttcacggcaacgcttttatagcgaaagcaatcgca
cgaggcgcggcggcaatcgtctatcaggatgatttgcccgaagacgcactgcgcgccgcc
gaagaaaggaacaacgaagcggaagcaccggtactcgtccgggtacgggacgcgcggttc
gccatgtcgcccgctgcggacgctttttacgattcaccgtcggaaaaactcgccgttatc
ggcgtaaccggtacggaaggcaaaagttcaaccgtatcgtttatctggcagctgctcgga
ctctgcggcaaaaaagcgggattcatttccaccgtgcagtactcgctcggagacgacgcg
atagccaatcccgaacatcagacgacgccggaagcacccatcgtgcagcggcagctctac
gaaatggtgcaaaacggatgcgagtacgccgtcgtggagtcttcttcccacggcctgtcc
cgtaaaacgaaccggctcggagacgtccgcttcgacgcgggcgtattcatgaacgttacg
cacgaacatctggaatttcacggtacgcacgaacaatataaaagcgacaaggcgaatctg
ttccgcgcgctcgacgcgcacgatcatctgaaaacgatcggcggcacacggcgcagggtt
cccgcgttcggcgtcgtcaatcttgaagaccccgccgccgcttatttcaacgacgccacg
gagaaaaccgtctacgggtttaccaccggcggagcggcaggcaaaaacgcggatattccg
ctgcctgaaattcctgccgaaattccccgcttttccgcagaccgcgttgcggcaaaatcg
gacggaatcgcttttaccgcaaacgttccgccctcggacacgattcgggccaccgcaccc
gacccggtcgccgtaacagcgccgctccccggcgcgttcaacgtatataacgtactcgcc
tcgctcatcacggtgagcacgataaccggcattccgtttgcacgcgttgccgaaaaatgc
ccgcagctgcagccggtaaaaggccgcatgaccgtcatcgacaaaggacagccctttgaa
gtgatcgtggattacgcgcacacgccgtcttcgttcgagaccatttttccgccgctccgt
aaacgcgcccggaaccgcattatcgtactgttcggctcaggcggcgaacgcgacaccaaa
aaacgcccggaacaaggccgcatcgccgcacgctggtgcgacgtcgtcattcttgccgac
gaagacccgcgcgcagaagatccggcggcgctgctcgagatgattgcggcgggctgccgc
agtgcgggcaaaaccgaaggaaacggactgtacgtcgttccgccgcgcccgcaagccatc
cgcaaagcgtttgccctcgccgctgaaggcgacatcgttttgctgctcggaaaagctcac
gaaaattcaattatatataaagattacaccatgccctacgatgaaatcgccgaagcggaa
aaagcgcttgccgaagcgggcttcaccggcaggacgggcggaggttcagtgtga

DBGET integrated database retrieval system