KEGG   Treponema brennaborense: Trebr_2121Help
Entry
Trebr_2121        CDS       T01489                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tbe  Treponema brennaborense
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Trebr_2121
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Trebr_2121
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Trebr_2121
Enzymes [BR:tbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Trebr_2121
Exosome [BR:tbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Trebr_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2509611..2511302)
Genome map
AA seq 563 aa AA seqDB search
MPVLYGKVTAAWLELRLVLQEVYCMNAIMTKVLTRVRRVCAAGMVCAAIGGVPLFAGGSP
EKNVSSINTDSTGNAARRGAAASDKKFVASPKYVFLFIGDGMSYPQIQSAAYFLGKDAAG
PVSQVQKSSDSADSPRAEALNFMQFPTAGSAQTYDATSFAPDSASTATSILTGHKTHSGS
INVDITKKIKYTTIAEQLKAQKNWKIGVVSSVNLNHATPAAMYAHQASRKSNYAIGEELV
ASGFDYFAGGALMEAQDKKKDKTSIYDLAKNAGYEVVFTQKEAESLTGGAGRKALVIGET
LADADSLSYENDRAPNEWALRDYVRKGVEFLENDTGFFMMVEGGKIDWACHANDAGSTIA
DTVALADAVAEAIAFYQAHPEDTLILVTGDHETGGLSIGFAGTDYDTWLDNLENQKISYA
KYDKEYVSAYKAAKTPFETVLADVEKLFGLVSPAKAAAAGNSRLVLTDYETDRLRAAYGK
TMNGGADTKNQAEYVLYGSYEPLTVTVTHVLNNKSGVNFASYAHTGIPVPVFAEGAGNEV
FGGYYDNTDIYRKLAALTGVAEK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttctgtacggtaaagttacggccgcttggctggagcttcggctggtattgcag
gaggtatattgtatgaatgcgattatgacaaaggttttgacgagagttcgccgcgtttgt
gcggcgggtatggtgtgtgcggcgatcggcggcgtgccgctttttgccggcggttcaccg
gaaaagaacgtttcttctattaatacggatagtacgggtaatgcggctcgtaggggagca
gccgcttccgataagaaattcgtcgcttctccgaaatacgtgtttttgtttatcggcgac
ggtatgagctatccgcagatacagagcgccgcgtattttttaggcaaggacgcggccggt
cctgtttcccaagtacagaagtcttccgactcagcggattcgccgcgagccgaagcgctg
aatttcatgcagtttccgaccgcgggcagcgcgcagacgtacgacgcgacgtcttttgct
ccggattcggcttcaaccgcgacgtcgattctgaccgggcataaaacgcactccggctcg
atcaacgtcgatatcacaaaaaagataaaatatacgacgattgcggaacaattgaaagcc
caaaaaaattggaaaatcggcgtcgtgtcttcggttaatttgaatcacgcgactcccgcg
gcgatgtacgcgcatcaggcgagccggaagagcaattacgctatcggtgaagaacttgtg
gcgagcggtttcgattattttgccggcggtgcgttgatggaagcgcaggataagaaaaaa
gataaaacgagcatttacgatttggcgaaaaacgccggatacgaggtcgtgtttacccaa
aaagaagccgaatcgctgaccggcggtgcgggacggaaggcgctcgttataggcgaaacg
ctcgccgatgcggattcgctcagttatgaaaacgaccgtgcgccgaacgaatgggcgctg
cgcgactacgtgcggaagggcgtcgagtttttggaaaacgataccggttttttcatgatg
gtcgagggcggaaaaatcgactgggcgtgccatgcgaacgacgccggttccactattgcg
gatacggttgcgcttgcggacgccgtggcggaagcgatcgcgttctatcaggctcatccc
gaagacacgctgattttggtaaccggagatcacgaaaccggcggcctttccatcggtttc
gcgggaaccgactacgacacctggctcgataatttggaaaatcagaaaatatcgtacgcc
aaatacgataaggaatacgtttcggcatataaagcggcgaaaactccgtttgaaacggtg
ctggccgacgttgaaaaactgttcggtttggtttctccggcaaaagcggctgcagccgga
aattcccggctcgtactgaccgactacgaaacggacaggctgcgcgcggcgtacggtaaa
acgatgaacggcggggcagataccaaaaatcaggcggaatacgttctgtacggttcgtac
gaaccgcttacggtaacggtaacgcacgtgctgaacaataagtcgggcgtgaacttcgct
tcgtacgcgcatacgggaattccggttcccgtgttcgccgagggcgcgggaaacgaggtg
ttcggcgggtattacgataataccgatatttaccgcaaacttgccgctttgacgggtgtt
gcggaaaaataa

DBGET integrated database retrieval system