KEGG   Treponema brennaborense: Trebr_2154Help
Entry
Trebr_2154        CDS       T01489                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tbe  Treponema brennaborense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tbe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tbe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tbe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tbe00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:tbe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2547066..2548757)
Genome map
AA seq 563 aa AA seqDB search
MILDRFVAGKSAYSSYEDLKENFSIRIPDNFNFAYDVVDEYARAEPDRRALVWCDDDGNE
KFFTFGDLKKASDKTANFLTMNGIRKGDAVMLILRRRYEFWFFILALHKIGAIAVPATHM
LLKKDIEYRNNAAGVKMIVSLEEPELQDQVEQALPDSPTVKTLVTVGPARSGWLCFHEAY
DSLSETFVRPTGELAAGNEDIMLLYFTSGTSGYPKMVQHDFTYPLGHIVTAKYWQNVVDG
GLHLTVAETGWAKAVWGKIYGQWLAGSAVFAYDMLSFVPGKLLEKMARYKVTTFCAPPTV
YRYLIKHDLSKYDLSSLTYCTTAGEALNAEVYNRFCEQTGLKMKEGYGQTELTLTIGNFA
WMEPKPGSMGKPAPGYEIDIVDAEGKSCAAGETGEIVIRLENGRPFGMFAGYYRDQELTD
AAFYGNLYHTGDTAYRDEDGYYWFVGRMDDMIKSAGYRISPFEVESTLLQHPAVLECAVT
GVADKKRSQVVKATIVPAPGFSPTQKLAQEIQDFVKHVTAAYKYPRLIEFVKELPKTISG
KIRRVEIREKDAQDRTAADENGR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataggttcgtcgccggaaaaagcgcatacagttcctacgaagatttaaaa
gaaaacttttccatccgtattcccgataacttcaattttgcgtacgacgtcgtggacgaa
tatgcccgtgccgaaccggatcgccgtgcgctcgtgtggtgcgacgacgacggtaacgaa
aaattttttacgttcggcgatttgaaaaaagcttccgacaaaaccgcgaatttcctgacg
atgaacggaatacgaaaaggcgacgcggttatgctgattttgcgccgccggtacgagttc
tggtttttcattctcgcactgcataaaatcggtgcgattgcggttcccgcgacgcacatg
ctgctcaaaaaagacatcgaataccgcaacaacgcggcgggtgtcaaaatgatcgtgtcg
cttgaagagcccgaactgcaggatcaggttgaacaggcgctgcccgattctccgacggtc
aaaacgctcgttaccgtggggcccgcccgctccggctggctgtgttttcacgaagcgtac
gactcgttgtctgaaacgttcgttcgaccgaccggtgaacttgccgccggtaacgaagac
atcatgctgctgtattttacgtcgggcacgtccggctatcctaaaatggtgcagcacgat
tttacgtatccgctgggccacatcgttacggccaaatattggcagaacgtggtcgacggc
ggactgcacctgacggttgccgaaaccggctgggcaaaagcggtgtggggtaaaatctac
ggtcagtggcttgccggcagcgccgtttttgcgtacgacatgctgtcgttcgttcccgga
aagctgcttgaaaaaatggcgcggtacaaggtgacgacgttttgcgcgccgccgaccgtc
tatcggtatcttatcaagcacgatctttcaaaatacgacctttcaagcctgacgtattgc
acgacggcgggcgaagcgctcaatgcggaagtatacaatcggttctgcgaacagaccggc
ctcaagatgaaagaaggttacggccagacggaactgacgctcacgatcggcaattttgcc
tggatggagccgaagcccggttccatgggaaaaccggcgcccggttacgagatcgatatc
gtcgacgccgaaggaaaatcctgtgcggccggcgaaacgggtgaaatcgttatcagactt
gaaaacggccgtccgttcggcatgttcgccggctattaccgcgatcaggaattgaccgac
gccgctttctatggaaatctgtatcacaccggagacacggcgtatcgcgacgaagacgga
tattactggtttgtcggccgaatggacgacatgataaaaagcgccggatatcgcatcagt
ccgttcgaggttgaaagcacgctgcttcagcatccggcggtcctcgaatgtgccgttacc
ggcgttgctgacaaaaagcgcagtcaggtcgtcaaagcgacgatcgttcccgcgcccggg
ttttctccgacccaaaaattggcgcaggagattcaggatttcgtaaagcacgtgaccgcc
gcgtataaatatccgcggctgatcgagttcgtcaaggaattgcccaaaacgatcagcggc
aaaatccgccgcgtggaaatacgcgaaaaagacgcgcaagatcggactgcggccgatgaa
aacggcagataa

DBGET integrated database retrieval system