KEGG   Treponema brennaborense: Trebr_2154Help
Entry
Trebr_2154        CDS       T01489                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tbe  Treponema brennaborense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trebr_2154
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trebr_2154
   00620 Pyruvate metabolism
    Trebr_2154
   00640 Propanoate metabolism
    Trebr_2154
  Energy metabolism
   00680 Methane metabolism
    Trebr_2154
Enzymes [BR:tbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Trebr_2154
Lipid biosynthesis proteins [BR:tbe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Trebr_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2547066..2548757)
Genome map
AA seq 563 aa AA seqDB search
MILDRFVAGKSAYSSYEDLKENFSIRIPDNFNFAYDVVDEYARAEPDRRALVWCDDDGNE
KFFTFGDLKKASDKTANFLTMNGIRKGDAVMLILRRRYEFWFFILALHKIGAIAVPATHM
LLKKDIEYRNNAAGVKMIVSLEEPELQDQVEQALPDSPTVKTLVTVGPARSGWLCFHEAY
DSLSETFVRPTGELAAGNEDIMLLYFTSGTSGYPKMVQHDFTYPLGHIVTAKYWQNVVDG
GLHLTVAETGWAKAVWGKIYGQWLAGSAVFAYDMLSFVPGKLLEKMARYKVTTFCAPPTV
YRYLIKHDLSKYDLSSLTYCTTAGEALNAEVYNRFCEQTGLKMKEGYGQTELTLTIGNFA
WMEPKPGSMGKPAPGYEIDIVDAEGKSCAAGETGEIVIRLENGRPFGMFAGYYRDQELTD
AAFYGNLYHTGDTAYRDEDGYYWFVGRMDDMIKSAGYRISPFEVESTLLQHPAVLECAVT
GVADKKRSQVVKATIVPAPGFSPTQKLAQEIQDFVKHVTAAYKYPRLIEFVKELPKTISG
KIRRVEIREKDAQDRTAADENGR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataggttcgtcgccggaaaaagcgcatacagttcctacgaagatttaaaa
gaaaacttttccatccgtattcccgataacttcaattttgcgtacgacgtcgtggacgaa
tatgcccgtgccgaaccggatcgccgtgcgctcgtgtggtgcgacgacgacggtaacgaa
aaattttttacgttcggcgatttgaaaaaagcttccgacaaaaccgcgaatttcctgacg
atgaacggaatacgaaaaggcgacgcggttatgctgattttgcgccgccggtacgagttc
tggtttttcattctcgcactgcataaaatcggtgcgattgcggttcccgcgacgcacatg
ctgctcaaaaaagacatcgaataccgcaacaacgcggcgggtgtcaaaatgatcgtgtcg
cttgaagagcccgaactgcaggatcaggttgaacaggcgctgcccgattctccgacggtc
aaaacgctcgttaccgtggggcccgcccgctccggctggctgtgttttcacgaagcgtac
gactcgttgtctgaaacgttcgttcgaccgaccggtgaacttgccgccggtaacgaagac
atcatgctgctgtattttacgtcgggcacgtccggctatcctaaaatggtgcagcacgat
tttacgtatccgctgggccacatcgttacggccaaatattggcagaacgtggtcgacggc
ggactgcacctgacggttgccgaaaccggctgggcaaaagcggtgtggggtaaaatctac
ggtcagtggcttgccggcagcgccgtttttgcgtacgacatgctgtcgttcgttcccgga
aagctgcttgaaaaaatggcgcggtacaaggtgacgacgttttgcgcgccgccgaccgtc
tatcggtatcttatcaagcacgatctttcaaaatacgacctttcaagcctgacgtattgc
acgacggcgggcgaagcgctcaatgcggaagtatacaatcggttctgcgaacagaccggc
ctcaagatgaaagaaggttacggccagacggaactgacgctcacgatcggcaattttgcc
tggatggagccgaagcccggttccatgggaaaaccggcgcccggttacgagatcgatatc
gtcgacgccgaaggaaaatcctgtgcggccggcgaaacgggtgaaatcgttatcagactt
gaaaacggccgtccgttcggcatgttcgccggctattaccgcgatcaggaattgaccgac
gccgctttctatggaaatctgtatcacaccggagacacggcgtatcgcgacgaagacgga
tattactggtttgtcggccgaatggacgacatgataaaaagcgccggatatcgcatcagt
ccgttcgaggttgaaagcacgctgcttcagcatccggcggtcctcgaatgtgccgttacc
ggcgttgctgacaaaaagcgcagtcaggtcgtcaaagcgacgatcgttcccgcgcccggg
ttttctccgacccaaaaattggcgcaggagattcaggatttcgtaaagcacgtgaccgcc
gcgtataaatatccgcggctgatcgagttcgtcaaggaattgcccaaaacgatcagcggc
aaaatccgccgcgtggaaatacgcgaaaaagacgcgcaagatcggactgcggccgatgaa
aacggcagataa

DBGET integrated database retrieval system