KEGG   Treponema brennaborense: Trebr_2205Help
Entry
Trebr_2205        CDS       T01489                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tbe  Treponema brennaborense
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Trebr_2205
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Trebr_2205
Enzymes [BR:tbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Trebr_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619598..2621376)
Genome map
AA seq 592 aa AA seqDB search
MAKLQIVRGRAGRGRFLGSAARTAAAVFLSVCFSFFAGAQAPSAQSAAAPIEAALPERIT
FWSDYPADVLADTLVSRMSDEELLAQIFMFGWAGQEPSELLNRWVVERGLGSVKVFGWNT
DNTTLVAESVVSLQQKSQQRRFQIPLFVATDQEGGWIRHVKGETSDTPGNLAIGASGYAA
DAWFSGYYISRELRALGINMNFAPTVDLYTNHDSSVIGPRSFGEDGDSVGVLGAAFTAGS
LAAGVIPTAKHFPGHGDTGVDSHGNLPVISIDLDTLLNRELVPFKYLIAEKIPAIMSGHL
SFPQIVPNGEPASLSKVFLTDILRTKLGYEGLIITDDMMMNGATMYAGNLSSAFRMAIEA
GNDIIISSTTAQLNEALWRSNLELMKTSAAFKARVADAARRVIHAKLVYFKSGTAVPLYP
DVSKIAESIPDPDGADFFLSQACRSISVFKGGSVPYAPAAGERILLAGQKQFPSFFSEAK
LRYPDAKFVQFNYAMGPNETEWMSDYLAGFAKDFDTVIICVADAASAAVAERLRQLDVKT
IVISVLAPFPAMKCDWADTVLLAYSYSPYSFAAVFGLLAGEFSARGTLPLSP
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattgcagattgtgcgcgggcgtgccgggcgcggccgttttttggggagcgcc
gcgcggacggcagcggccgtttttctatccgtatgcttctcgttttttgccggtgcgcag
gccccttccgcgcaatctgccgctgcgccgattgaagcggctctgcccgaacggattacg
ttctggagcgattatccggcggacgtgcttgcggatacgctcgtttcgcgcatgagcgac
gaagaactgcttgcgcagattttcatgttcggctgggcgggacaggaaccgtccgagctt
ttgaaccgctgggtggtggagcgcggactgggcagtgtgaaagtattcggctggaacacg
gacaacacgacgctcgttgcggaatccgttgtcagtttacaacagaaatcccaacagcgc
agattccaaatcccgctgttcgtcgcgaccgatcaggaaggcggctggattcggcacgtg
aaaggcgaaacgagcgacacgccgggaaaccttgcaatcggtgcttcaggatatgcggcg
gacgcttggttcagcggctattacatcagccgggaattgcgtgcgctcggaatcaatatg
aattttgcgccgacggtcgatttgtatacgaatcacgattccagcgtcatcggtccgcgt
tcgttcggcgaagacggtgattcggtgggcgtgctgggcgcggcttttaccgcgggatct
ttggcggccggagtcattccgacggcgaagcattttcccggtcacggcgacaccggcgtc
gattcccatggaaatctgccggttatttctatcgatctcgacacgctgctgaatcgggaa
ttggtgccgttcaaatatctgatcgcggaaaaaattcccgcgattatgtccggtcatttg
agttttccgcagatcgttccgaacggcgagccggcgtcgctttcaaaggtattcctgacg
gatattctgcgaaccaagctcggctacgaggggctgatcattaccgacgacatgatgatg
aacggcgctacgatgtacgcggggaatctttcgtccgcgttcagaatggcgattgaagcc
ggaaacgatatcattatttcgtctacgacggctcagttgaacgaagcgctgtggcgctcc
aatctggaactgatgaagacgtccgcggcgtttaaagcgcgcgttgccgacgctgcccgg
cgggtcattcatgccaaattggtttatttcaaaagcggtacggccgttccgctgtatccc
gacgtgtcgaaaatagcggaatcgattcccgatcccgacggggcggatttttttctgtct
caggcgtgccggtcgatctccgtattcaagggcggcagcgttccgtatgcgcctgctgcg
ggcgagcgtatcctgctggccgggcagaagcagttcccttcgtttttttcggaagcaaaa
ctgcgttatcccgacgcaaaattcgtgcagttcaattacgcgatggggccgaacgagacg
gaatggatgtccgattaccttgccggttttgcgaaggatttcgacaccgtgattatctgc
gttgcagacgcggcgagcgcggcggttgccgagcggctgcggcagcttgacgtcaagacg
atcgttatatcggtcttggcgccgtttcccgcgatgaaatgcgattgggccgataccgtt
ctgctggcgtacagttattcgccgtattcgttcgccgcagtgttcggcctgcttgccggt
gaattcagcgcgcgcggaacgctgccgctttctccgtaa

DBGET integrated database retrieval system