KEGG   Treponema brennaborense: Trebr_2238Help
Entry
Trebr_2238        CDS       T01489                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tbe  Treponema brennaborense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Trebr_2238
Enzymes [BR:tbe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Trebr_2238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2651410..2653458
Genome map
AA seq 682 aa AA seqDB search
MKISNSFKYTSLTGTAVPLGALKTARSCGSGEYPDLIPFTDFCKKAGLGIVQLLPVNDTG
TESSPYSALSAFALHPLYVSIDSVPEYAEVPAAEKQLTALHQKHDGNGRFRYRELRNDKT
ALLRMIFDARRDVITASAETPDAELNGWIKANEWVKEYAVFMELKRTYREASWKEWPQKY
RRLSSAQIAKRWNDPALKSAHVFYAWLQMRTAQQFKKAADYAADNGVILKGDIPIMMNED
SADAWAHPEFFDDTLRAGSPPDGPNPVGQNWGFPIYRWDNLAKSGYSWWKQRLVSAAQYY
KAYRIDHVLGFFRIWATSERETTAALGHTQPSAPITQAELAAAGFDDDRIRWLSQPHVPT
RSIKAVNGGDYLGTHGLLHKLMDRIGTEELWRFKPEIAGDKDIWETPDVPDPVKAKLAEH
WRDRTLTQIRPGTYSPLWTYRETSAWKSLSQDEQHRLGTLIADKNARMERLWEAQARTLL
GELTGVTDMIACAEDLGANPESLPRVLADLSIMRLCVVRWCRHWEQPGQPFTRFEAYPAL
SVATSSVHDSSTLRLWWLTESDAHDFFGNFPPDARGSNFTAERNPPAPPGSYTPETARYL
LTEIARANSRFCIHPIQDLLGLSRTYYAADPQKERVNIPGSVSEFNWTYRLPVPIETLAQ
DAALIGAVRQIADAHSAAHGSV
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagtaatagttttaaatacacttcgctcaccggaacagccgttccgctcggc
gctttaaaaacggcgcggagctgcggctccggagaatatcctgatctgattccgtttacg
gacttctgcaaaaaagcgggactcggcatcgtgcaattgcttccggtaaacgacaccggc
acggaaagttcaccgtacagcgcgctgtcggcgttcgcactgcatccgctgtacgtcagc
atcgattccgtccccgaatacgccgaagttccggctgcggaaaaacagcttaccgccctg
catcaaaaacacgacggaaacgggcgattccgctatcgcgaactgcggaacgataaaacg
gcgctgctgcgtatgatattcgacgctcgccgagacgtcattaccgcaagcgccgaaacg
ccggacgccgaactgaacgggtggatcaaggcgaacgaatgggtaaaagaatatgcggtt
tttatggagctcaaacgcacgtaccgcgaagcgtcctggaaagaatggccgcaaaaatac
cgccggctgtcatccgcacagatcgccaaacgatggaacgatccggcgctcaaatcggca
cacgtgttttacgcctggcttcaaatgcgcaccgcgcagcaattcaaaaaagcggccgat
tatgcggcggacaacggggtgattctgaaaggcgacattccgatcatgatgaacgaagat
tccgccgacgcctgggcgcatcccgagtttttcgacgacacgctgcgcgcaggttcgccg
cctgacggtccgaatccggtgggtcaaaactggggatttccaatataccggtgggacaat
ttggcaaaatccggctattcgtggtggaaacagcgactcgtcagcgcagcgcaatattat
aaagcgtaccgcatcgatcacgtgctgggttttttccgcatttgggcaacgagcgaacgc
gaaacgaccgccgcgctcgggcacacgcagccttccgcgccgataacgcaggcggaactt
gccgccgcaggcttcgacgacgaccggatccgctggctcagtcagccgcacgtgcccacg
cgttccataaaagcggtaaacggcggcgattatttgggaacgcacggactgctgcacaag
ctgatggaccgcatcggaacggaagaactctggcggttcaaacccgaaattgccggcgac
aaggatatttgggaaacgccggacgtccccgatccggtaaaagcgaaactcgccgagcac
tggagagatcgtacgctgacgcagattcgccccggaacgtattcgccgctgtggacgtac
cgcgaaacgtccgcctggaaatcgctgtctcaggacgaacagcacagactcggcacgctg
atcgcggataaaaacgcacggatggaacggctgtgggaagcgcaggcgcgcaccctgctg
ggcgaactcaccggagttacggacatgatagcctgtgccgaagatctgggagcgaatccc
gaatcgctgccgcgcgttcttgcggatctttcgatcatgcggctgtgcgtcgtgcgctgg
tgcagacactgggaacagccggggcagccgttcacccgatttgaagcgtatcccgcgctg
agcgtcgcaacctcgtcggtgcacgactcctccacgctcaggctgtggtggcttaccgaa
agcgacgcgcacgattttttcggaaattttccgcccgatgcccgcggctcgaatttcact
gccgaacggaacccgcccgcccctcccggttcgtacacaccggaaacggcgcgctatctg
ctgacggaaatcgcccgggcgaacagccggttctgcatccatccgatacaggacttgctc
ggcctgagccgaacgtattacgccgccgatccgcaaaaggagcgcgtcaatattcccggc
agcgtatccgagttcaactggacgtaccggctgccggttccgattgaaacgctcgcacag
gacgcggcgcttatcggcgccgtcagacagatcgccgacgctcattcggccgcgcacggt
tcggtctga

DBGET integrated database retrieval system