KEGG   Treponema brennaborense: Trebr_2240Help
Entry
Trebr_2240        CDS       T01489                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tbe  Treponema brennaborense
Pathway
tbe00260  Glycine, serine and threonine metabolism
tbe00750  Vitamin B6 metabolism
tbe01100  Metabolic pathways
tbe01110  Biosynthesis of secondary metabolites
tbe01120  Microbial metabolism in diverse environments
tbe01230  Biosynthesis of amino acids
Module
tbe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trebr_2240
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Trebr_2240
Enzymes [BR:tbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Trebr_2240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEE17649
UniProt: F4LL75
Position
complement(2657679..2658989)
Genome map
AA seq 436 aa AA seqDB search
MQFVSTRDRKNVVSFSQAITDCMAPDGGLYVPAYADNLGPWVYYLNDKTSFASLAGSLTS
ALIKEEFSPIISEAIATGAFPFSPGFRRLDDSLYQLELFTGPTGSHKDFGVSYLAACLEY
TLLMQDKNAIVVAVTDGEIGASVVQAMRGKKHLKAVLLYVKGTMRGFNESDCVWNGGNVY
PVEVDGTVEECNRLVGAVFADREAVSSYGLTLVNTANIGRLLPQTFFYMYAFSRLKKKVF
GDIFYALAPGNYGNLAAGLYGWKFSLPVNGFITECTPSLTVDPFNRCEVLDAVVPLENRG
PADPASPSNLERLEEVFFTNPAVLKGMVFPVPVSQTEREAACKELFMKYGEFADGETSGA
YAAAKNHIDAFHTDDSTVVLVARDHPAFHVDRIRRCCGEAPEIPAHIAALLEPVTPVKRI
PPELSHVIRICAELKG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcgtcagtacccgtgaccgcaaaaacgtcgtgagtttctctcaggcgattacc
gactgtatggctcccgacggcggtttgtacgtgcccgcgtacgcggataatttggggccg
tgggtctattatttgaacgacaaaacgtcttttgcttctctcgcaggttctcttacctcc
gctcttataaaggaagaattcagcccgatcatatcggaagcgattgcgaccggcgcgttt
ccgttcagtcccggattccgccggctcgacgattctctgtatcagcttgaactgtttacc
ggcccgaccggttcgcataaggatttcggcgtgtcgtatttggcggcctgcttggaatac
acgctgctgatgcaggataaaaacgcgatcgtggtcgccgttaccgacggagaaatcggc
gccagcgtcgtacaggcgatgcgcggtaaaaaacatctgaaagccgttttgctgtacgtt
aagggtacgatgcgcggattcaatgagagcgactgcgtctggaacggcggaaacgtatat
ccggtcgaagtggacgggacggttgaagaatgtaatcggctcgtcggagccgtttttgcc
gaccgcgaagcggtttcgtcgtacgggcttacgttggtgaacacggcgaatatcggccga
ttgctgccgcagacgtttttttatatgtacgcgttttcacggcttaaaaaaaaggtgttc
ggagatattttttacgcactcgcgccgggcaattacggtaatcttgcagccggcttgtac
ggctggaagttctcgctgccggtgaacggttttatcaccgaatgcacgccgtctttgacc
gttgatccgttcaatcggtgcgaagtgctggacgcggtcgttccgcttgaaaaccgcgga
ccggcggatccggccagtccctcgaatcttgagcggctggaggaagtattttttacgaac
cctgccgtgctgaaaggcatggtctttcccgttcccgtttctcagacggagcgcgaagcc
gcctgcaaagaacttttcatgaaatacggtgaattcgcggacggcgaaacgtccggcgcg
tatgcggcggcgaaaaaccatatcgacgcgttccatacggacgacagtacggtggtgctc
gttgcgcgcgatcatccggcgtttcacgttgaccgaatccgccgctgctgcggagaagct
cccgaaattccggcgcatatcgccgcccttttggaaccggtaacgccggtaaagcggatt
ccgccggagctttcgcacgtaataaggatatgtgcggaattgaaaggctga

DBGET integrated database retrieval system