KEGG   Treponema brennaborense: Trebr_2240Help
Entry
Trebr_2240        CDS       T01489                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tbe  Treponema brennaborense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trebr_2240
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trebr_2240
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Trebr_2240
Enzymes [BR:tbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Trebr_2240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2657679..2658989)
Genome map
AA seq 436 aa AA seqDB search
MQFVSTRDRKNVVSFSQAITDCMAPDGGLYVPAYADNLGPWVYYLNDKTSFASLAGSLTS
ALIKEEFSPIISEAIATGAFPFSPGFRRLDDSLYQLELFTGPTGSHKDFGVSYLAACLEY
TLLMQDKNAIVVAVTDGEIGASVVQAMRGKKHLKAVLLYVKGTMRGFNESDCVWNGGNVY
PVEVDGTVEECNRLVGAVFADREAVSSYGLTLVNTANIGRLLPQTFFYMYAFSRLKKKVF
GDIFYALAPGNYGNLAAGLYGWKFSLPVNGFITECTPSLTVDPFNRCEVLDAVVPLENRG
PADPASPSNLERLEEVFFTNPAVLKGMVFPVPVSQTEREAACKELFMKYGEFADGETSGA
YAAAKNHIDAFHTDDSTVVLVARDHPAFHVDRIRRCCGEAPEIPAHIAALLEPVTPVKRI
PPELSHVIRICAELKG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcgtcagtacccgtgaccgcaaaaacgtcgtgagtttctctcaggcgattacc
gactgtatggctcccgacggcggtttgtacgtgcccgcgtacgcggataatttggggccg
tgggtctattatttgaacgacaaaacgtcttttgcttctctcgcaggttctcttacctcc
gctcttataaaggaagaattcagcccgatcatatcggaagcgattgcgaccggcgcgttt
ccgttcagtcccggattccgccggctcgacgattctctgtatcagcttgaactgtttacc
ggcccgaccggttcgcataaggatttcggcgtgtcgtatttggcggcctgcttggaatac
acgctgctgatgcaggataaaaacgcgatcgtggtcgccgttaccgacggagaaatcggc
gccagcgtcgtacaggcgatgcgcggtaaaaaacatctgaaagccgttttgctgtacgtt
aagggtacgatgcgcggattcaatgagagcgactgcgtctggaacggcggaaacgtatat
ccggtcgaagtggacgggacggttgaagaatgtaatcggctcgtcggagccgtttttgcc
gaccgcgaagcggtttcgtcgtacgggcttacgttggtgaacacggcgaatatcggccga
ttgctgccgcagacgtttttttatatgtacgcgttttcacggcttaaaaaaaaggtgttc
ggagatattttttacgcactcgcgccgggcaattacggtaatcttgcagccggcttgtac
ggctggaagttctcgctgccggtgaacggttttatcaccgaatgcacgccgtctttgacc
gttgatccgttcaatcggtgcgaagtgctggacgcggtcgttccgcttgaaaaccgcgga
ccggcggatccggccagtccctcgaatcttgagcggctggaggaagtattttttacgaac
cctgccgtgctgaaaggcatggtctttcccgttcccgtttctcagacggagcgcgaagcc
gcctgcaaagaacttttcatgaaatacggtgaattcgcggacggcgaaacgtccggcgcg
tatgcggcggcgaaaaaccatatcgacgcgttccatacggacgacagtacggtggtgctc
gttgcgcgcgatcatccggcgtttcacgttgaccgaatccgccgctgctgcggagaagct
cccgaaattccggcgcatatcgccgcccttttggaaccggtaacgccggtaaagcggatt
ccgccggagctttcgcacgtaataaggatatgtgcggaattgaaaggctga

DBGET integrated database retrieval system