KEGG   Treponema brennaborense: Trebr_2244Help
Entry
Trebr_2244        CDS       T01489                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tbe  Treponema brennaborense
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Trebr_2244
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Trebr_2244
Enzymes [BR:tbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Trebr_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2661745..2663040
Genome map
AA seq 431 aa AA seqDB search
MNNPYEYRIEGGFPIKGTVTVSGNKNAALPCIAAALLTAEPVVLQNVPDIKDTGVMLQIL
EALGASVKKIAANAWEICAADPIRTEIPQELSKKLRASILFAGPLTARTGKATLPPPGGD
VIGRRRLDTHFLALTELGARVAVNGQFAFTANKLVGADIFLDEASVTATENAVMAAVLAE
GHTIITNAASEPHVQDLCKMLNAMGAKIGGVGSNILEIDGVTELHGCTYRIGPDYMEIGS
FIGLAAATRGSVTICGVEPRDLRPVKLAFGKLGITWHIEGDSLTVPVGQAMQVNTDLGGM
IPKIDDSPWPGFPPDLTSIMTVVATQVEGTVLIHEKMFESRMFFVDKLIGMGARITLCDP
HRAVVSGPCTLHGDHLVSPDVRAGMAMVIAAMAAHGESVISNVYQVERGYEHLIERLQSL
GAHIEKADCGD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaataatccgtacgaataccgaattgaaggcggattcccgatcaaaggaaccgttacg
gtaagcggcaacaaaaacgccgccctgccgtgcatcgcggcggcgctgctcaccgcggaa
ccggtcgttttgcagaacgtgcccgatataaaagataccggcgtcatgctgcaaattctt
gaagcgctcggtgcttcggtaaaaaagatcgccgccaacgcctgggagatctgtgccgcc
gatccgatccgcaccgaaattccgcaggaactttcaaaaaaactgcgggcgtcgatccta
ttcgccggcccgctcacggcgagaaccggcaaggcaacactgcctccgcccggcggcgac
gtcatcggacggaggcggctcgacacgcactttctggcgctcactgaactgggagcgcgc
gtggcggtaaacggacagttcgcgtttaccgcgaacaaactggtgggagcggacattttt
cttgacgaagcgtcggttaccgccacggaaaacgccgtcatggcggccgtgcttgccgag
ggacacacgatcatcacgaacgccgcaagcgaaccgcacgtacaggatttgtgcaaaatg
ctgaacgcgatgggcgcaaaaatcggcggcgtcggcagcaatattctggaaatagacggc
gttaccgaattgcacggctgcacgtaccgcatcggccccgattacatggaaataggttcg
tttatcggactcgcggcggctacgcgcggcagcgttaccatatgcggcgttgaaccgcgc
gatctgcgcccggtcaaattggcgttcggaaagctcggcatcacgtggcatatcgaaggc
gattcgctcaccgttcccgtcggacaggcgatgcaggtaaacacggatttgggcggtatg
attcccaaaatagacgactcaccgtggcccggatttccgcccgatctgacgagcataatg
acggtcgtcgcgacgcaagttgaaggaaccgtcctgattcacgaaaaaatgtttgaatcg
cggatgtttttcgtcgacaagctgatcggcatgggcgcgcgcatcacgctgtgcgacccg
caccgcgccgtcgtgtcggggccgtgcacgctgcacggtgatcatctggtttcacccgac
gtgcgagcaggcatggcgatggtcattgccgcaatggccgcgcacggcgaaagcgttatc
agcaatgtgtatcaggtcgaacgcggctacgaacatctgatcgaacgtctccaaagtctc
ggcgctcatattgaaaaagccgactgcggtgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system