KEGG   Treponema brennaborense: Trebr_2362Help
Entry
Trebr_2362        CDS       T01489                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tbe  Treponema brennaborense
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trebr_2362
  Amino acid metabolism
   00340 Histidine metabolism
    Trebr_2362
Enzymes [BR:tbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Trebr_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2783414..2784733
Genome map
AA seq 439 aa AA seqDB search
MTAIKTVPAAQLPAAFFEPRIFEKDTEATVSDILRRVRTDKDAALHEFARKFDRADPHSF
QIAQSDLDCAVRRLEAENAALHGALCYSHDLALRFALKQRESFTNFEAELEPGIITGQRT
IAVDRAGLYVPAGRFPLLSTVIMASAPAIAAGCGEVVLCTPPRPHPNDKTLPYADEGIMA
AAALCGVHRVFACGGAQAIAAMAYGTESIPRCDVIVGPGNKFVAEAKRQVYGTAGIDMIA
GPTEVFIIADSTANPAWIAADMLAQAEHDPDAQAVLATPDAALARNVSAELEKQLAALAT
AEIARTSIERHGLIIITDSLEQAARIADKKAPEHLELALEAGPALDALAASVRNYGSLFI
GHGSAEVLGDYAAGLNHTLPTSTSARFTGGLSVRCFLKTVTTLRTKGESAGFHASAEAAS
ILGETEGLAGHAHAARIRL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgattaaaaccgtaccggcggcgcagctgcccgccgcgttttttgagccccgt
atatttgaaaaagatacggaagcaaccgtttcggatattctccgccgcgtgcgaacggac
aaagacgccgccctgcacgaattcgcacgaaaattcgaccgggccgatccgcactcgttc
caaatagcgcagagcgatctcgactgcgccgtacggcggcttgaagcggagaacgcggcg
ctgcacggcgcgttgtgttattcgcatgatctcgcgctgcgcttcgcactcaaacagcgg
gaatcgttcacgaactttgaagcggaactggaaccgggaatcatcaccggacagcgcacg
atagccgtcgatcgcgccggcttgtacgttcccgccggccggtttccgctgctttcaacg
gtaatcatggcttccgcgccggcgatcgcagccggctgcggtgaagtcgtcctgtgcacg
ccgccgcgcccgcatcccaacgataaaacgcttccctatgcggacgaaggcatcatggcc
gccgccgccttgtgcggcgtacaccgcgtgtttgcctgcggcggcgcgcaggcgatcgcc
gccatggcgtacggtacggaatcgataccgcgctgcgacgtcatcgtcggcccggggaat
aaattcgtcgcggaagccaagcgccaagtgtacggcaccgccggcatcgacatgatcgcg
ggtcctaccgaagtattcatcattgccgattccacggcgaatccggcatggatcgcggcg
gacatgctcgcacaagccgaacacgaccccgacgcgcaagccgtcctcgcgacgccggac
gcggcgcttgcccgcaacgtgagcgcggaacttgaaaaacaactcgccgcgctcgccact
gccgaaatagcccgcaccagcatcgaacggcacggcctgatcatcataacggattcgctc
gaacaggccgcccgcattgcggataaaaaagcgccggaacatcttgaactggcactcgaa
gcagggccggcgctcgacgcgctggcggcaagcgtccgcaattacggttcgcttttcatc
ggacacggttcggccgaagttctgggcgactacgcggcgggactgaatcacacgctgccg
acgtcgacgtcggcgcgttttacgggcgggctttcagtacgctgttttctgaaaacggtt
acgacgcttcggacgaaaggcgaatccgcagggtttcacgcttccgcggaagcggcaagc
attttgggagagacggaaggactcgcgggccacgcacacgccgcccgcatcaggttatag

DBGET integrated database retrieval system