KEGG   Treponema brennaborense: Trebr_2414Help
Entry
Trebr_2414        CDS       T01489                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
tbe  Treponema brennaborense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Trebr_2414
DNA repair and recombination proteins [BR:tbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Trebr_2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2842339..2842926)
Genome map
AA seq 195 aa AA seqDB search
MNALEELTESFSRLPGIGKKSASRISNYLLKADRGFMLRFAQQIAVLQDKIKPCSVCGSY
TEEDPCAICSDPLRERNLLCVVEQPQDVQTIEASREFRGLFHVLGGVIAPLDGVGPEQLS
IGKLMERLGDGSVTEVIIATNPTVEGDTTALYLQKLLAKTGVTVTRLASGLPVGGDLEYA
DRLTLARSFRGRAAF
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcttgaagagttgacggaatccttttcccggcttccggggatcggaaaaaaa
agtgcgtcccggatatccaattatctgctcaaagcggaccgcggattcatgctgcgtttt
gcccagcagatagcggtgcttcaggataaaataaaaccgtgttccgtgtgcggctcgtat
acggaagaagatccgtgtgcgatttgttcggatccgctgcgggagcgaaatttgctgtgt
gtggttgaacagccgcaggacgtgcagaccatagaagcgtcgcgcgagttccgcggcttg
tttcacgtactcggcggtgtgatcgcgccgctcgacggcgtggggccggaacagctttcg
atcggaaagctgatggaacgcctcggcgacggttccgttaccgaagttatcatcgcaacg
aacccgacggttgaaggcgacacgacggcgctgtatttacagaaactgctggccaaaacc
ggcgtaaccgtaacgcgccttgcgtcgggattgccggtcggcggtgatcttgaatacgcc
gaccgattgacgctcgcccgcagctttcgcggacgggcggcgttttaa

DBGET integrated database retrieval system