KEGG   Treponema brennaborense: Trebr_2488Help
Entry
Trebr_2488        CDS       T01489                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tbe  Treponema brennaborense
Pathway
tbe00511  Other glycan degradation
tbe00600  Sphingolipid metabolism
tbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Trebr_2488
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Trebr_2488
Enzymes [BR:tbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Trebr_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: AEE17894
UniProt: F4LND6
Position
2938818..2940254
Genome map
AA seq 478 aa AA seqDB search
MNITRIFETAKDSRQRLAELPGESRLITDPKINPCIITVKPEARFQTVTGFGGAITESAG
YVVSKLPPHVRQEAVDACFSARNGNNYTYARTHLNSCDFSLENWACVPQKDETLDSFSME
RTDRYVTPLLKAAKIAANTSNDPDDANGAAGTKADRFRLMVTPWSPPAWMKDNDCMNGGG
HLKPEYRRLWAQYFVRFLSELQKRGLRTGIVSIQNEPAAVQRWDSCIWSAEEEAEFAVRY
LGPALRQSGFADTDILVWDHNRDLLWDRFAASMAVPGAADYIAGAAYHWYSGDQYDNVRK
IAERFPDKQIVFSEGCIEGGPRDGAWFSGERYAHNIINDLSNGCTAWIDWNIVLDMNGGP
NHAGNYCDAPILADIAAGTLHYQSSYYYIGHFSRFIRPGAVRLGAETTPYMVPAAVDGKL
GNTIENCAFLNPDGSIVFIICNRTEADLPYELKIDGTADSARTLRCPPRAIQTLIIRR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaacataacacgcatatttgaaacggcaaaagattcccggcagcgccttgcggagctg
cccggcgaatcgcggctgattacggacccgaaaatcaatccgtgtatcataacggtaaaa
ccggaagcccgattccaaacggtaacgggtttcggcggcgcaatcacggaatccgcggga
tacgtcgtatcgaaacttccgccgcacgtacggcaggaagcggtcgacgcctgtttcagc
gcgcggaacggcaacaattacacgtatgcccggacgcacctgaattcctgtgatttctcg
ctcgaaaactgggcgtgcgtccctcaaaaggatgaaacgcttgattctttttccatggag
cggacggatcggtacgttacgccgctgctgaaagcggcgaagatcgccgcaaatacctcg
aatgacccggacgacgcaaacggtgccgccgggacgaaagcggatcggttccggctcatg
gtaacgccttggtcgccgccggcctggatgaaagacaacgactgtatgaacggcggcgga
catctgaagcccgaataccgccggctgtgggcgcagtatttcgtacggtttctctccgaa
ctgcaaaaacgcggcctgcgcaccggcatcgtcagcattcagaacgaaccggcggccgta
cagcgctgggattcgtgcatttggtcggcagaagaagaagcggaattcgccgtccgatat
ctgggacccgcgctgcggcaatcgggatttgccgatacggatattttggtatgggatcac
aatcgggatctgctgtgggaccgattcgccgcgtcgatggcggtgcccggcgccgccgat
tatatcgcgggagccgcgtaccattggtactcgggagaccaatacgacaacgtccggaaa
attgccgaacgctttccggacaaacaaatcgttttttccgaaggctgcatagaaggcggc
ccccgcgacggcgcttggttttccggagagcgatatgcgcataatatcatcaacgatctc
agcaacggctgcacggcgtggatagactggaacatcgttctcgatatgaacggcggcccg
aatcacgcgggaaattactgcgacgcaccgattcttgccgatatcgccgccggaacgctg
cattatcaaagttcttattattatatagggcatttcagccgatttatccgtccgggcgca
gtccgtctcggcgcggaaacgactccgtacatggtgccggccgccgtcgacggaaagctg
ggaaacacgatagaaaactgcgcgtttctgaatcccgacggctcaatcgtgttcatcatc
tgcaacagaacggaagcggatctgccgtacgaactgaaaatagatggtacggcggattcc
gcccggacgctccgctgtccgccccgcgcgattcagacgctgattatccgccggtaa

DBGET integrated database retrieval system